PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS74409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 150aa    MW: 17336.9 Da    PI: 9.5549
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS74409.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding642.9e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv++++++G g+W++ ++  g++R++k+c++rw +yl
       EPS74409.1 14 KGPWTPEEDEKLVEYIRKHGHGSWRALPKFAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding58.51.5e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+e +++++  lG++ W++Ia +++ gRt++++k++w+++l
       EPS74409.1  67 RGKFSQEEEETILNLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-28564IPR009057Homeodomain-like
PROSITE profilePS5129419.542961IPR017930Myb domain
SuperFamilySSF466893.05E-3311108IPR009057Homeodomain-like
SMARTSM007171.3E-161363IPR001005SANT/Myb domain
PfamPF002496.7E-191461IPR001005SANT/Myb domain
CDDcd001671.23E-121661No hitNo description
PROSITE profilePS5129427.14262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2865117IPR009057Homeodomain-like
SMARTSM007175.9E-1766114IPR001005SANT/Myb domain
PfamPF002495.4E-1767112IPR001005SANT/Myb domain
CDDcd001678.55E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDEKLVEYIR KHGHGSWRAL PKFAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEETILN LHSILGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG  120
YDPVTHQPRT DFFSSLPHLI ALATLKEIVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011022802.11e-102PREDICTED: myb-related protein 308-like
SwissprotQ8GWP02e-74MYB39_ARATH; Transcription factor MYB39
TrEMBLS8D3W51e-110S8D3W5_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0005s07590.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-99myb domain protein 93
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]