PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73952.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family ZF-HD
Protein Properties Length: 199aa    MW: 22271.6 Da    PI: 8.6933
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73952.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.81.4e-293486357
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                 +v+Y+eC+kNhAa++GghavDGCgEfm+     +  +a+kCaACgCHRnFHR+ +
   EPS73952.1 34 AVEYRECMKNHAAHIGGHAVDGCGEFMKP--VYAAGDAMKCAACGCHRNFHRQVM 86
                 689************************98..445689***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-243585IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.8E-243684IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-153784IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.4133785IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.1E-29124197IPR009057Homeodomain-like
SuperFamilySSF466891.08E-18125194IPR009057Homeodomain-like
TIGRFAMsTIGR015656.2E-28136192IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
DSEIDTPPHA AQPVIIRPLS FSKILPPAPP SVPAVEYREC MKNHAAHIGG HAVDGCGEFM  60
KPVYAAGDAM KCAACGCHRN FHRQVMSPLI LYFADIDFQV TQPGILFPFR NGLTPSPPEE  120
RQQAPVTPMG NSLSGRKRFR TKFSQEQKDK MHSFSEKIGW KMQKCDDSEV RDFCSEIGVS  180
RGVFKVWMHN NKTLIAKKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-201371921873ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022878317.12e-62zinc-finger homeodomain protein 10-like
TrEMBLS8EMN51e-148S8EMN5_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_009788342.15e-57(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10882485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28920.18e-47homeobox protein 34
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]