PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73948.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 211aa    MW: 24344.1 Da    PI: 8.497
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73948.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-1656101147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed++l+++v  +G+ +W++Ia+++  gR++k+c++rw++ 
       EPS73948.1  56 RGHWRPVEDLKLKELVSIYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 101
                      899*****************************.***********996 PP

2Myb_DNA-binding57.82.4e-18108152147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +++ eE+e+lv a++++G++ W+ Iar ++ gRt++ +k++w+ +
       EPS73948.1 108 RRAFSDEEEERLVAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHVV 152
                      6789******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.98151102IPR017930Myb domain
SMARTSM007175.0E-1455104IPR001005SANT/Myb domain
PfamPF002497.5E-1656101IPR001005SANT/Myb domain
SuperFamilySSF466892.96E-2756149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-2557109IPR009057Homeodomain-like
CDDcd001673.60E-1259100No hitNo description
PROSITE profilePS5129427.014103157IPR017930Myb domain
SMARTSM007178.4E-15107155IPR001005SANT/Myb domain
PfamPF002492.6E-14108151IPR001005SANT/Myb domain
CDDcd001678.20E-11110153No hitNo description
Gene3DG3DSA:1.10.10.602.0E-20110156IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MAFPNWGFSF LNNGEGKSSD SCGDSIDLNT TLYEEDEGCN AWSNKDGSGQ SKLCSRGHWR  60
PVEDLKLKEL VSIYGPQNWN LIAEKLEGRS GKSCRLRWFN QLDPRINRRA FSDEEEERLV  120
AAHRLYGNKW AMIARLFPGR TDNAVKNHWH VVMARKYREQ SSSHRRRKMG QIVCHQRAEE  180
NGISPEMEPS HGGRSWGPPH HYFLPGQNHD H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31561577108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070989.13e-90PREDICTED: transcriptional activator Myb
TrEMBLS8EDA51e-158S8EDA5_9LAMI; Uncharacterized protein
STRINGSolyc05g007870.1.13e-85(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16842470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.13e-74myb domain protein 105
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]