PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 278aa    MW: 31166.1 Da    PI: 7.5482
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73580.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W+++++  g+ R+ k+c++rw +yl
       EPS73580.1 14 KGPWTPEEDIILVSYIQEHGPGNWRAVPANTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding44.43.7e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++ E+  ++++ ++lG++ W++Ia +++  Rt++++k++w+++l
       EPS73580.1  67 RGNFSPHEEGMIIHLQALLGNK-WAAIATYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.485965IPR017930Myb domain
SuperFamilySSF466892.82E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002491.8E-161461IPR001005SANT/Myb domain
CDDcd001678.43E-121661No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2465117IPR009057Homeodomain-like
SMARTSM007171.7E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129418.57666116IPR017930Myb domain
PfamPF002491.3E-1267112IPR001005SANT/Myb domain
CDDcd001677.29E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRAV PANTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF SPHEEGMIIH LQALLGNKWA AIATYLPQRT DNDIKNYWNT HLKKKLKMLQ  120
SESQLAGDNS AACHNFLSKP PPQHNKNHNN NLVYASSAEN ISRLLEGWMR SSSSPNSNLT  180
QSKFHRDPGG YFSESSDVIR CIENDPDVNE LNCIVSFDHN ALASRFDKSS CDSTHKESAF  240
GIDTMAKSDN PPLSFLEKWL LDENAGHGEA VMELASLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-24141164105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-231411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-231411658159MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-231211625128MYB TRANSFORMING PROTEIN
1mse_C6e-24141164105C-Myb DNA-Binding Domain
1msf_C6e-24141164105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069952.11e-116PREDICTED: myb-related protein 306
SwissprotP813922e-85MYB06_ANTMA; Myb-related protein 306
TrEMBLS8D2F10.0S8D2F1_9LAMI; Uncharacterized protein
STRINGPOPTR_0013s06390.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-99myb domain protein 60
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]