PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73373.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GRF
Protein Properties Length: 140aa    MW: 16525.1 Da    PI: 10.0742
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73373.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.55.7e-2483125244
         WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  epgrC+RtDGKkWRCsr+v + +k+CErHlhrgr rsrk++e
  EPS73373.1  83 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHLHRGRPRSRKHVE 125
                 69***************************************98 PP

2QLQ49.21.6e-172357236
         QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                +FT aQ+ +L  Q+++yKy+a+++PvPpeLl +++
  EPS73373.1 23 PFTFAQWKELQIQAMIYKYMASSVPVPPELLYPLS 57
                8******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.4E-92258IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.5372358IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.3E-132356IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.05982126IPR014977WRC domain
PfamPF088791.1E-1984125IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MNKQLFDDFC YQSSGSAAAV EFPFTFAQWK ELQIQAMIYK YMASSVPVPP ELLYPLSRTS  60
SSSPCKKIFL ASFCLLRMRN RDLEPGRCKR TDGKKWRCSR DVAPHQKYCE RHLHRGRPRS  120
RKHVEVYTHR LLKEDGYFLQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015872909.17e-50growth-regulating factor 4-like, partial
RefseqXP_015872939.11e-49growth-regulating factor 6-like, partial
SwissprotQ9FJB83e-37GRF7_ARATH; Growth-regulating factor 7
TrEMBLS8EBU31e-101S8EBU3_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_009791786.11e-47(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-39growth-regulating factor 7
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Cao Y,Han Y,Jin Q,Lin Y,Cai Y
    Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa).
    Front Plant Sci, 2016. 7: p. 1750
    [PMID:27933074]