PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73275.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family CO-like
Protein Properties Length: 297aa    MW: 32441.3 Da    PI: 5.4781
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73275.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.72.1e-071143436
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                + C+ ++  +++ fC+ ++ ++C  C   +H  
  EPS73275.1 11 KLCDSCKAAPATVFCRADSAFICVPCDGRIHAA 43
                68*************************999954 PP

2zf-B_box26.71.2e-085397341
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                 ++C+ +e+ +++  C+ +   lC++C   +H+       H++ p
  EPS73275.1 53 VWVCEVCEQAPASVTCKADAAALCASCDRDIHSAnplarrHDRHP 97
                689*****************************6688888855544 PP

3CCT70.93.2e-24248292145
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                 Rea++lRYkeKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  EPS73275.1 248 REARVLRYKEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSE 292
                 9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.1E-13855IPR000315B-box-type zinc finger
PROSITE profilePS5011910.125855IPR000315B-box-type zinc finger
PfamPF006431.9E-51149IPR000315B-box-type zinc finger
CDDcd000214.38E-91255No hitNo description
PROSITE profilePS5011910.3385198IPR000315B-box-type zinc finger
PfamPF006431.2E-65397IPR000315B-box-type zinc finger
CDDcd000216.17E-85499No hitNo description
SMARTSM003362.9E-75698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.638248290IPR010402CCT domain
PfamPF062032.7E-18248290IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGGQGWSLTA KLCDSCKAAP ATVFCRADSA FICVPCDGRI HAANKLASRH ARVWVCEVCE  60
QAPASVTCKA DAAALCASCD RDIHSANPLA RRHDRHPVVA FYDAASAVKS SAAENFSEEE  120
AEAASWLLPD PNAKAEEDED SGSPEYKSAE YLFTDMDPYL DLDLIAGEEK TEKKEYSTDG  180
VVPGPIVDGY PSYDVEYAAT PKPFMYSFAS SQSMSHSVSL SSSCSMEVGV VPEQGSIPMA  240
TAVSGSDREA RVLRYKEKRK NRKFEKTIRY ASRKAYAETR PRIKGRFAKR SELEVDS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078988.11e-142zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-86COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
SwissprotQ9SK532e-87COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLS8D1K60.0S8D1K6_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.A00403.1.p1e-128(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.17e-83CONSTANS-like 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  3. Tripathi P,Carvallo M,Hamilton EE,Preuss S,Kay SA
    Arabidopsis B-BOX32 interacts with CONSTANS-LIKE3 to regulate flowering.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. 172-177
    [PMID:27999181]