PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 140aa    MW: 16490.8 Da    PI: 11.0929
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73052.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-17451148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll++ +  +G g+W++ a+  g++Rt+k+c++rw++yl
       EPS73052.1  4 RGPWTLEEDNLLIQHIGFHGEGRWNSLAKSAGLKRTGKSCRLRWLNYL 51
                     89*********************************************7 PP

2Myb_DNA-binding47.34.7e-1557100146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E+ l++++  ++G++ W++Ia+ ++ gRt++++k++w++
       EPS73052.1  57 RGNLSPQEQILILELQSKWGNR-WSKIAQNLP-GRTDNEIKNYWRT 100
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.49155IPR017930Myb domain
SuperFamilySSF466895.08E-30298IPR009057Homeodomain-like
SMARTSM007176.5E-15353IPR001005SANT/Myb domain
PfamPF002492.5E-16451IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-22558IPR009057Homeodomain-like
CDDcd001671.14E-10651No hitNo description
SMARTSM007171.8E-1356104IPR001005SANT/Myb domain
PROSITE profilePS5129419.12256106IPR017930Myb domain
PfamPF002496.0E-1457100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2259105IPR009057Homeodomain-like
CDDcd001671.75E-961100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
EVRRGPWTLE EDNLLIQHIG FHGEGRWNSL AKSAGLKRTG KSCRLRWLNY LKPDIKRGNL  60
SPQEQILILE LQSKWGNRWS KIAQNLPGRT DNEIKNYWRT RVQKQARRLQ ADSNSGEFLE  120
AIRRLQWMPG LVEKMNQQQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-26110624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070788.13e-78PREDICTED: transcription factor MYB24
SwissprotQ9LK952e-60MYB21_ARATH; Transcription factor MYB21
TrEMBLS8EKC72e-98S8EKC7_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc05g009230.1.12e-77(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-75myb domain protein 62
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]