PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72941.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 118aa    MW: 14114.2 Da    PI: 11.2078
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72941.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.7e-17550147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l ++v+ +G+ +W++Ia++++ gR++k+c++rw++ 
       EPS72941.1  5 RGHWKPSEDAKLRELVAVFGPQNWNLIAEKLQ-GRSGKSCRLRWYNQ 50
                     899*****************************.************96 PP

2Myb_DNA-binding57.23.7e-1857101147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++++eE+ +lv+a++ +G++ W++I+r ++ gRt++ +k++w+ +
       EPS72941.1  57 RTAFSEEEEVRLVEAHRAYGNK-WALISRLFP-GRTDNAVKNHWHVL 101
                      678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.644155IPR017930Myb domain
SMARTSM007172.2E-14453IPR001005SANT/Myb domain
SuperFamilySSF466895.86E-295102IPR009057Homeodomain-like
PfamPF002497.7E-17551IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-27658IPR009057Homeodomain-like
CDDcd001671.25E-11849No hitNo description
SMARTSM007176.0E-1556104IPR001005SANT/Myb domain
PROSITE profilePS5129421.5856106IPR017930Myb domain
PfamPF002492.1E-1557101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2059106IPR009057Homeodomain-like
CDDcd001671.75E-959102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
KYCTRGHWKP SEDAKLRELV AVFGPQNWNL IAEKLQGRSG KSCRLRWYNQ LDPRINRTAF  60
SEEEEVRLVE AHRAYGNKWA LISRLFPGRT DNAVKNHWHV LMARRIREKS KPNYVRRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3441066108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070989.17e-66PREDICTED: transcriptional activator Myb
RefseqXP_010108682.12e-65Transcription factor
SwissprotQ9FDW11e-36MYB44_ARATH; Transcription factor MYB44
TrEMBLS8D6B49e-84S8D6B4_9LAMI; Uncharacterized protein (Fragment)
STRINGGSMUA_Achr5P27750_0011e-64(Musa acuminata)
STRINGVIT_14s0108g01010.t014e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16842470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-66myb domain protein 105
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]