PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72933.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family NAC
Protein Properties Length: 158aa    MW: 18738.5 Da    PI: 9.6279
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72933.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.1e-51101381129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw Lp  +k +++ewyfFs rd+kyatg r+nrat++gyWkatgkd++++++ +  
  EPS72933.1  10 LPPGFRFYPSDEELVCHYLYKKISKEEVVR-GTLVEIDLHTCEPWMLPDVAKLNSNEWYFFSFRDRKYATGYRTNRATTTGYWKATGKDRPIVDTkTYG 107
                 79*************************777.78***************87778899*************************************975566 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                 +vg++ktLvfy++rap+g kt+W+mhe+rle
  EPS72933.1 108 VVGMRKTLVFYRNRAPNGLKTSWIMHEFRLE 138
                 7***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-609156IPR003441NAC domain
PROSITE profilePS5100557.2810156IPR003441NAC domain
PfamPF023653.8E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MGLRDIGDTL PPGFRFYPSD EELVCHYLYK KISKEEVVRG TLVEIDLHTC EPWMLPDVAK  60
LNSNEWYFFS FRDRKYATGY RTNRATTTGY WKATGKDRPI VDTKTYGVVG MRKTLVFYRN  120
RAPNGLKTSW IMHEFRLENP HLPPKEDWVL CRVFYKSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-47915716166NO APICAL MERISTEM PROTEIN
1ut4_B2e-47915716166NO APICAL MERISTEM PROTEIN
1ut7_A2e-47915716166NO APICAL MERISTEM PROTEIN
1ut7_B2e-47915716166NO APICAL MERISTEM PROTEIN
4dul_A2e-47915716166NAC domain-containing protein 19
4dul_B2e-47915716166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007050267.11e-103PREDICTED: NAC domain-containing protein 21/22
RefseqXP_012442853.11e-103PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8514e-59NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLS8EAP01e-115S8EAP0_9LAMI; Uncharacterized protein (Fragment)
STRINGGorai.001G254300.11e-102(Gossypium raimondii)
STRINGEOX944241e-103(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-89NAC domain containing protein 74
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  3. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  4. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  5. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  6. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]