PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72726.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 120aa    MW: 14119.2 Da    PI: 10.2561
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72726.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEde+lv ++k++G g+W++ ++  g+ R++k+c++rw +yl
       EPS72726.1 14 RGKWSAEEDEKLVSYIKKHGEGNWRSLPHNAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding59.85.8e-1967112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+e++v ++++lG++ W++Ia+ ++ gRt++++k++w+++l
       EPS72726.1  67 RGNFTPDEEEIIVVLHNMLGNK-WALIAKQLP-GRTDNDIKNYWNSHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.247961IPR017930Myb domain
SuperFamilySSF466891.31E-3111108IPR009057Homeodomain-like
SMARTSM007171.4E-141363IPR001005SANT/Myb domain
PfamPF002491.6E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-241568IPR009057Homeodomain-like
CDDcd001673.34E-111661No hitNo description
PROSITE profilePS5129425.71662116IPR017930Myb domain
SMARTSM007172.1E-1666114IPR001005SANT/Myb domain
PfamPF002492.7E-1767112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-2769116IPR009057Homeodomain-like
CDDcd001679.40E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MGRKACCDKT GLKRGKWSAE EDEKLVSYIK KHGEGNWRSL PHNAGLLRCG KSCRLRWMNY  60
LRSDLKRGNF TPDEEEIIVV LHNMLGNKWA LIAKQLPGRT DNDIKNYWNS HLSRRLYEFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071652.16e-64PREDICTED: transcription factor MYB12
RefseqXP_012840518.12e-64PREDICTED: transcription repressor MYB6
SwissprotP278985e-62MYBP_MAIZE; Myb-related protein P
TrEMBLS8D5L74e-85S8D5L7_9LAMI; Uncharacterized protein (Fragment)
STRINGBRADI1G24887.11e-61(Brachypodium distachyon)
STRINGscaffold_801313.18e-62(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.18e-65myb domain protein 111
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]