PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72587.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 108aa    MW: 12700.6 Da    PI: 10.5829
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72587.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-16451148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
       EPS72587.1  4 KGLWSPEEDEKLMNYMLNNGQGCWSEIARNSGLSRCGKSCRLRWINYL 51
                     678*******************************************97 PP

2Myb_DNA-binding55.21.7e-1757101147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++ 
       EPS72587.1  57 RGPFSPQEEELILHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 101
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.761155IPR017930Myb domain
SuperFamilySSF466893.99E-30298IPR009057Homeodomain-like
SMARTSM007174.7E-12353IPR001005SANT/Myb domain
PfamPF002492.1E-14451IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-24558IPR009057Homeodomain-like
CDDcd001671.83E-8751No hitNo description
PROSITE profilePS5129419.87356106IPR017930Myb domain
SMARTSM007172.7E-1656104IPR001005SANT/Myb domain
PfamPF002495.4E-1657100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-2759105IPR009057Homeodomain-like
CDDcd001672.65E-105999No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
KLRKGLWSPE EDEKLMNYML NNGQGCWSEI ARNSGLSRCG KSCRLRWINY LRPDLKRGPF  60
SPQEEELILH LHSILGNRWS QIAARLPGRT DNEIKNFWNS TMKKRNKS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-2921055107B-MYB
1h8a_C1e-28110524127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045019.12e-68PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV27e-65MYB46_ARATH; Transcription factor MYB46
TrEMBLS8EIZ59e-75S8EIZ5_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_06s0004g02110.t012e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-57myb domain protein 46
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]