PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72475.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 147aa    MW: 16756.2 Da    PI: 10.2977
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72475.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv++++ +G+g+W+  +r  g+ R++k+c++rw +yl
       EPS72475.1 14 KGPWTAEEDAKLVQYIQIHGPGNWRILPRNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.82.2e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ +E+e +++++  lG++ W++Ia++++ gRt++++k++w+++
       EPS72475.1  67 RGRFSFDEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.481965IPR017930Myb domain
SuperFamilySSF466891.16E-3111108IPR009057Homeodomain-like
SMARTSM007174.3E-141363IPR001005SANT/Myb domain
PfamPF002497.5E-161461IPR001005SANT/Myb domain
CDDcd001672.57E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129419.86966116IPR017930Myb domain
SMARTSM007177.1E-1666114IPR001005SANT/Myb domain
PfamPF002498.9E-1667111IPR001005SANT/Myb domain
CDDcd001673.42E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MGRSPCCDKD GLKKGPWTAE EDAKLVQYIQ IHGPGNWRIL PRNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFDEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRIG  120
IDPITHGPRL DIFDLSSILA SSSSSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-30121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-30121162105C-Myb DNA-Binding Domain
1msf_C6e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137011.12e-93PREDICTED: transcription repressor MYB6-like
SwissprotQ8GWP03e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLS8CZH71e-105S8CZH7_9LAMI; Uncharacterized protein (Fragment)
STRINGAT4G21440.14e-91(Arabidopsis thaliana)
STRINGPOPTR_0019s14070.17e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-88MYB-like 102
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]