PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 169aa    MW: 19286.1 Da    PI: 10.0629
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72419.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT eEd++l  ++ q+G+++W++I+++ g+ R++k+c++rw +yl
       EPS72419.1 14 RGQWTSEEDQKLSSYISQHGTRNWRLIPKHAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding48.52e-1568110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++ E+e +v ++  lG++ W+ Ia+ ++ gRt++++k++w++
       EPS72419.1  68 GQFSEAEEETIVTLHSVLGNR-WSVIAAQLP-GRTDNDVKNHWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.639965IPR017930Myb domain
SuperFamilySSF466894.49E-3011108IPR009057Homeodomain-like
SMARTSM007171.0E-131363IPR001005SANT/Myb domain
PfamPF002491.6E-171461IPR001005SANT/Myb domain
CDDcd001678.52E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2465116IPR009057Homeodomain-like
SMARTSM007172.4E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129420.06766116IPR017930Myb domain
PfamPF002491.2E-1368110IPR001005SANT/Myb domain
CDDcd001674.42E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MGRIPCCEKE NVKRGQWTSE EDQKLSSYIS QHGTRNWRLI PKHAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SEAEEETIVT LHSVLGNRWS VIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKPFS HLITEIATLP PPQAPNLAEA ALGCFKDEML HLLTKRRTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32141177109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248353.11e-114PREDICTED: protein ODORANT1
SwissprotQ9XHV01e-109MYB80_ARATH; Transcription factor MYB80
TrEMBLS8CYD11e-125S8CYD1_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc10g005760.1.11e-114(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-110myb domain protein 103
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]