PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72406.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 878aa    MW: 97033.6 Da    PI: 4.8534
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72406.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161157148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde l  av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
       EPS72406.1 11 KGQWTQEEDEVLRIAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 57
                     799****************************9.************986 PP

2Myb_DNA-binding62.21e-1963109148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W+++Ede+++++vk++G + W+tI+++++ gR +kqc++rw+++l
       EPS72406.1  63 KGPWSKQEDEIIIQLVKKYGAKKWSTISQHLP-GRIGKQCRERWHNHL 109
                      79******************************.*************97 PP

3Myb_DNA-binding42.31.7e-13115157145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+ E++ l++a++ +G++ W+   + ++ gR+++ +k++w+
       EPS72406.1 115 KEAWTQNEELMLIRAHQIYGNK-WAELTKFLP-GRSDNAIKNHWN 157
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.312657IPR017930Myb domain
SuperFamilySSF466891.79E-15764IPR009057Homeodomain-like
SMARTSM007171.6E-121059IPR001005SANT/Myb domain
PfamPF002497.6E-141157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-231368IPR009057Homeodomain-like
CDDcd001674.54E-121457No hitNo description
PROSITE profilePS5129432.60958113IPR017930Myb domain
SuperFamilySSF466891.68E-3060156IPR009057Homeodomain-like
SMARTSM007179.6E-1962111IPR001005SANT/Myb domain
CDDcd001671.57E-1665109No hitNo description
PfamPF139213.7E-1866124No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2769112IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-20113164IPR009057Homeodomain-like
SMARTSM007171.2E-12114162IPR001005SANT/Myb domain
PROSITE profilePS5129417.162114164IPR017930Myb domain
CDDcd001671.05E-9117157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 878 aa     Download sequence    Send to blast
RTSGPTRRST KGQWTQEEDE VLRIAVQRFK GKNWKKIAEC FKDRTDVQCL HRWQKVLNPE  60
LVKGPWSKQE DEIIIQLVKK YGAKKWSTIS QHLPGRIGKQ CRERWHNHLN PNINKEAWTQ  120
NEELMLIRAH QIYGNKWAEL TKFLPGRSDN AIKNHWNSSV KKKLEMYLAS GLLSQFEGSP  180
LRLPNQSMAS SSSKAQQCSE ADDFVGVDTA EMSECSQGSA AVSAPQPDMT GITHNREECG  240
ATENSSSVLC AEDYYPAFEE ANFGIPEDQS GMGEQCREND LCLDLDALSE ADWHIDPNKL  300
PEISLIDLGE EIPGLPLTSL SGPVDSSAAF DSSSSFDDMV VGDAPGLVAD LEDRMLYSEV  360
NRNEPGTSKT VNPEYGGQGD RLLHCPTFQI AAPESCCMPL DMLESALSES PPSSALRPPA  420
ETPSIFTEKL KQLSCSLQGN AGVYVSPRRR DDFVYSKESD SSPCADEVVF EGKESPRLVP  480
ANDFVLEQLN ETHSSSPFEE NFTAADKQAP GTLYYEPPRF PSLDIPFFSC DLIQSGSEIQ  540
QEYSPFGIRQ LMMSSVTPFK LWDSPSRGDD ASPEAVLKSA AKTFSGTPSI LRKRHRDLMS  600
PLSEKRDEKK PSNQDSFSSL ADDFSKLDML LDGFADAKGL PMPVSPKIKN LEVPCAEKEN  660
GGCIKTTGAS KSIESNMLSD STDASKTTEK DLGGVLVEHN INDLHFLSPH EFGSKAFGRR  720
LDSKQQHVLP SSSENSFVSP RLGAKRDCSS GSKPIAASSS ICRNSRCVDT AFKRRLESPS  780
AWKSPWFLNT DITIEDFGYF VSPGECSYDA IGLMKQLGEH TAATFADAQE VLGDETPETI  840
MKKAASSPSP SSNFFKRCIL VWLQVERRVL DFSECGSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-67111646159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-67111646159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089667.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_011089748.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_011089827.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_011089911.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_011089990.10.0PREDICTED: myb-related protein 3R-1 isoform X1
SwissprotQ9S7G71e-114MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLS8D4X30.0S8D4X3_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc08g068320.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31072448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-159myb domain protein 3r-4
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]