PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 251aa    MW: 28423.7 Da    PI: 4.947
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72350.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26e-163986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ +ar  g++R++k+c++rw +yl
       EPS72350.1 39 KGLWSPEEDEKLMNYMSTNGQGCWSDVARNAGLRRCGKSCRLRWINYL 86
                     678*******************************************97 PP

2Myb_DNA-binding538.2e-1792136147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ eE+el+++++ +lG++ W+ Ia +++ gRt++++k++w++ 
       EPS72350.1  92 RGAFSSEEEELILHLHSLLGNR-WSQIATRLP-GRTDNEIKNFWNST 136
                      89********************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9433486IPR017930Myb domain
SuperFamilySSF466898.61E-2937133IPR009057Homeodomain-like
SMARTSM007172.5E-123888IPR001005SANT/Myb domain
PfamPF002491.3E-143986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-234093IPR009057Homeodomain-like
CDDcd001672.65E-94286No hitNo description
PROSITE profilePS5129425.88287141IPR017930Myb domain
SMARTSM007171.4E-1591139IPR001005SANT/Myb domain
PfamPF002494.5E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2594140IPR009057Homeodomain-like
CDDcd001671.19E-1094134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MERDILSEST STMAKASSDP PSRKKRAPAS DGNNVKLRKG LWSPEEDEKL MNYMSTNGQG  60
CWSDVARNAG LRRCGKSCRL RWINYLRPDL KRGAFSSEEE ELILHLHSLL GNRWSQIATR  120
LPGRTDNEIK NFWNSTMKKK RLKNSSANSS NGNYVSPEFR ADLAGDETMM IVNMNMFVEP  180
SSSSPPPLQQ LPMTFPDDVD DPFGRNPSFD LDAKVERDDG EDFGGFWGVS ELYEEVMKDF  240
PTTSFLGFQD E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-293414022127MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136143MKKKRLKN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004507092.11e-69PREDICTED: transcription factor MYB46
TrEMBLS8CZ960.0S8CZ96_9LAMI; Uncharacterized protein
STRINGVIT_06s0004g02110.t014e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-55myb domain protein 83
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]