PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71772.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WRKY
Protein Properties Length: 80aa    MW: 9164.31 Da    PI: 9.4995
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71772.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.72.8e-341977159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                ldDgy+WrKYGqK v+g+++prsYY+Cts gC v+k+ver+++dp++v++ Yeg+Hnhe
  EPS71772.1 19 LDDGYRWRKYGQKLVRGNPNPRSYYKCTSIGCAVRKHVERARNDPNAVITSYEGKHNHE 77
                59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.8E-37579IPR003657WRKY domain
SuperFamilySSF1182902.22E-301179IPR003657WRKY domain
PROSITE profilePS5081137.0571479IPR003657WRKY domain
SMARTSM007742.1E-361978IPR003657WRKY domain
PfamPF031061.9E-262077IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
VEDGKPRVIV QTVSEVDILD DGYRWRKYGQ KLVRGNPNPR SYYKCTSIGC AVRKHVERAR  60
NDPNAVITSY EGKHNHEVPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-381079877Probable WRKY transcription factor 4
2lex_A1e-381079877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683807.16e-41PREDICTED: uncharacterized protein LOC104898419
SwissprotQ6VWJ61e-42WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLS8EGG57e-54S8EGG5_9LAMI; Uncharacterized protein (Fragment)
STRINGBRADI1G23340.15e-40(Brachypodium distachyon)
STRINGPGSC0003DMT4000766705e-40(Solanum tuberosum)
STRINGPGSC0003DMT4000574095e-40(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21242462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.12e-42WRKY family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]