PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71765.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 211aa    MW: 23597.9 Da    PI: 10.3842
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71765.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
       EPS71765.1 14 KGPWTPEEDHKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.51.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
       EPS71765.1  67 RGKFTLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.362961IPR017930Myb domain
SuperFamilySSF466893.67E-3111108IPR009057Homeodomain-like
SMARTSM007171.0E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001673.13E-101661No hitNo description
PROSITE profilePS5129426.33362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2765116IPR009057Homeodomain-like
SMARTSM007175.8E-1766114IPR001005SANT/Myb domain
PfamPF002498.3E-1767112IPR001005SANT/Myb domain
CDDcd001677.11E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDHKLLAYIE EHGHGSWRAL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF TLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLTKMG  120
IDPVTHTPKN DALLSNDGQA KSAANLSHMA QWESARLEAE ARLVRQSKLR SAGSTSAQMQ  180
HHGAAVDQPA RCLDVLKAWS GGVAWGKAND V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098652.11e-127PREDICTED: myb-related protein 306-like
RefseqXP_016479806.11e-127PREDICTED: myb-related protein 306-like
SwissprotQ8GWP03e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLS8CXQ71e-156S8CXQ7_9LAMI; Protein 1 (Fragment)
STRINGPGSC0003DMT4000033821e-126(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-111myb domain protein 16
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]