PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71747.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family bZIP
Protein Properties Length: 287aa    MW: 32587.5 Da    PI: 9.4719
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71747.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.12.6e-10131434
                XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeek 34
                +k +rr ++NReAAr+sR RKka++++Le+ 
  EPS71747.1  1 DKMQRRQAQNREAARKSRMRKKAYVQQLETA 31
                589*************************974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0049180IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.117144IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.13E-7237No hitNo description
Gene3DG3DSA:1.20.5.1704.7E-7244No hitNo description
PfamPF001702.9E-7235IPR004827Basic-leucine zipper domain
PROSITE patternPS000360520IPR004827Basic-leucine zipper domain
PfamPF141445.6E-24104167IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
DKMQRRQAQN REAARKSRMR KKAYVQQLET ARMKLAHLEL QLQRARQHGF LITPPPPPPG  60
MGMYGTVNLG IAAFEMEYGQ WMDEQERKTS DLKTLLLLHP SDDATEELLH LTVDSVLSHY  120
CDLFRMKRDV ARYDSFYLVS GMWRTPLERF FLWIGGFRPS EIITVVKPHL GQLTEQQMAG  180
VGNLKQSCVQ AEDALSQGID KLQQTLSQGV AFLAEGVGNY ASQTASAMEK LESLEGFIGQ  240
ADHLRQKTLH QMARILTARQ AAMGLVAFGE YFLRLRGLSA LWTARYP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Required to induce the systemic acquired resistance (SAR) via the regulation of pathogenesis-related genes expression. Binding to the as-1 element of PR-1 promoter is salicylic acid-inducible and mediated by NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters. {ECO:0000269|PubMed:12897257}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097899.11e-140transcription factor TGA4 isoform X2
SwissprotQ392341e-110TGA3_ARATH; Transcription factor TGA3
TrEMBLS8EGE30.0S8EGE3_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.C00214.1.p1e-132(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.61e-104bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  3. Gangadharan A,Sreerekha MV,Whitehill J,Ham JH,Mackey D
    The Pseudomonas syringae pv. tomato type III effector HopM1 suppresses Arabidopsis defenses independent of suppressing salicylic acid signaling and of targeting AtMIN7.
    PLoS ONE, 2013. 8(12): p. e82032
    [PMID:24324742]
  4. Herrera-Vásquez A, et al.
    Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis.
    Plant Mol. Biol. Rep., 2018.
    [PMID:26696694]
  5. Fang H, et al.
    The Ca2+ /calmodulin2-binding transcription factor TGA3 elevates LCD expression and H2 S production to bolster Cr6+ tolerance in Arabidopsis.
    Plant J., 2017. 91(6): p. 1038-1050
    [PMID:28670772]
  6. Sarkar S, et al.
    Interaction of Arabidopsis TGA3 and WRKY53 transcription factors on Cestrum yellow leaf curling virus (CmYLCV) promoter mediates salicylic acid-dependent gene expression in planta.
    Planta, 2018. 247(1): p. 181-199
    [PMID:28913593]