PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 207aa    MW: 23163.7 Da    PI: 9.7093
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71496.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46.1e-172471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++lv+ +k+ G g+W++ ++  g+ R++k+c++rw +yl
       EPS71496.1 24 KGPWTSEEDDKLVEFIKRNGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 71
                     79******************************99************97 PP

2Myb_DNA-binding52.21.4e-1677122148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++l v++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
       EPS71496.1  77 RGPFTVEEEKLVVQLHAILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 122
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-241574IPR009057Homeodomain-like
PROSITE profilePS5129416.7961971IPR017930Myb domain
SuperFamilySSF466894.12E-3021118IPR009057Homeodomain-like
SMARTSM007171.1E-122373IPR001005SANT/Myb domain
PfamPF002492.3E-152471IPR001005SANT/Myb domain
CDDcd001672.47E-92671No hitNo description
PROSITE profilePS5129425.35272126IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2675126IPR009057Homeodomain-like
SMARTSM007173.7E-1576124IPR001005SANT/Myb domain
PfamPF002492.8E-1577122IPR001005SANT/Myb domain
CDDcd001671.23E-1079122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
FLVGEVLFCL MGRAPCCDKK GLKKGPWTSE EDDKLVEFIK RNGHGSWRSL PKLAGLLRCG  60
KSCRLRWTNY LRPDIKRGPF TVEEEKLVVQ LHAILGNRWA AIASQLPGRT DNEIKNLWNT  120
HLKKRLILMG IDPQTHEPAS SAATAAAASP ATRHMAQWES ARLEAEARLS QESFLLSAPP  180
AIGGTQESDF FLRLWNSEVG ETFRKLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31221265108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051856.11e-117Myb domain protein 17 isoform 1
SwissprotQ50EX65e-67ODO1_PETHY; Protein ODORANT1
SwissprotQ8GWP06e-67MYB39_ARATH; Transcription factor MYB39
TrEMBLS8D2861e-152S8D286_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_15s0046g03190.t011e-110(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-104myb domain protein 17
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]