PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71187.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family bZIP
Protein Properties Length: 336aa    MW: 35553.3 Da    PI: 7.8611
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71187.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_163.83.2e-20270332163
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 e+elkr++rk +NRe+ArrsR+RK+a  +eL++++++L++eN +L+ el++lk e+++l +++
  EPS71187.1 270 ERELKRQKRKLSNRESARRSRLRKQADFDELAQRAEALKEENASLRAELSRLKAEYEQLVAQN 332
                 89********************************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077772.7E-22774IPR012900G-box binding protein, multifunctional mosaic region
PfamPF165962.1E-38114253No hitNo description
Gene3DG3DSA:1.20.5.1702.0E-17266330No hitNo description
SMARTSM003381.0E-20270334IPR004827Basic-leucine zipper domain
PfamPF001702.7E-18270332IPR004827Basic-leucine zipper domain
PROSITE profilePS5021713.196272335IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11273329No hitNo description
CDDcd147021.55E-23275325No hitNo description
PROSITE patternPS000360277292IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
TFQDHTSAAS GAVPADWASF QAYSPMPPHG FLASSPQAHP YIWGVQQFIP PYGTSPHPYV  60
TMYPHGGLYA HPTMAPGTYP FSPYGMPSPN GVAEPSSNAA GPETGGKSPE GKGKLPIKRS  120
KGSLGSLNMI TGKVNEPERH LSGAAANGSH PKSCETASGG SSEGSDANSQ HESQVKSGDQ  180
SSDQGEELPQ NGVAAQSSQN GRSIPPHGMM TSTLPIVPVP AVGAVSGIPG PATNLNIGID  240
YWGTTPTPSS SIPGSGSRDS IQPQMYIQDE RELKRQKRKL SNRESARRSR LRKQADFDEL  300
AQRAEALKEE NASLRAELSR LKAEYEQLVA QNASLK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1272279LKRQKRKL
2286292RRSRLRK
3286293RRSRLRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds to the G-box motif (5'-CACGTG-3') and other cis-acting elements with 5'-ACGT-3' core, such as Hex, C-box and as-1 motifs. Possesses high binding affinity to G-box, much lower affinity to Hex and C-box, and little affinity to as-1 element (PubMed:18315949). G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control (Probable). Binds to the G-box motif 5'-CACGTG-3' of LHCB2.4 (At3g27690) promoter. May act as transcriptional repressor in light-regulated expression of LHCB2.4. Binds DNA as monomer. DNA-binding activity is redox-dependent (PubMed:22718771). {ECO:0000269|PubMed:18315949, ECO:0000269|PubMed:22718771, ECO:0000305|PubMed:18315949}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00291DAPTransfer from AT2G35530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082307.11e-165bZIP transcription factor 16-like isoform X1
RefseqXP_011082308.11e-165bZIP transcription factor 16-like isoform X1
RefseqXP_011082309.11e-165bZIP transcription factor 16-like isoform X1
SwissprotQ501B21e-123BZP16_ARATH; bZIP transcription factor 16
TrEMBLS8EF480.0S8EF48_9LAMI; Uncharacterized protein (Fragment)
STRINGEMJ104011e-146(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30652446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35530.11e-121basic region/leucine zipper transcription factor 16
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]