PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71175.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family bZIP
Protein Properties Length: 198aa    MW: 23510.9 Da    PI: 6.3704
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71175.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.81.6e-1589147563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN++L+++l++ ++  +++ +e+
  EPS71175.1  89 RKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRNENHQLIDKLNHVSERHDRVLQEN 147
                 689*********************************************99999888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.8E-1485149IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.63487150IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-1289161No hitNo description
PfamPF001705.1E-1389146IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.09E-1389139No hitNo description
CDDcd147025.57E-1990141No hitNo description
PROSITE patternPS00036092107IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MQPTEVSHHR HCLLTPTTAA QFPAQFGFFP NATDMMTPLY RFNKLPNNDN TLLYHQQPQI  60
QSPGSTCFSN HNSTSDEADE QRLSILHERK QRRMISNRES ARRSRMRKQR HLDELWSQVM  120
WLRNENHQLI DKLNHVSERH DRVLQENAQL KEETTELKQI ITDMRFNTPY DDTFPHLDDD  180
DDDDDGNDFG KRLSQKHD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101108RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099071.14e-74basic leucine zipper 43
SwissprotQ9FMC23e-43BZP43_ARATH; Basic leucine zipper 43
TrEMBLS8CWH31e-146S8CWH3_9LAMI; Uncharacterized protein
STRINGMigut.H00570.1.p1e-62(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.13e-55basic leucine-zipper 42
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]