PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS70087.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 164aa    MW: 19086.4 Da    PI: 8.7883
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS70087.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.4e-08249348
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                      W+ eE +l+ +a ++l ++    ++t a++++  +  +++ s++q++l
       EPS70087.1  2 CWSSEENKLFENALAELQPDspgFFETLASCVP-WKPINDITSHYQSLL 49
                     5*****************99*************.************986 PP

2Myb_DNA-binding45.32e-1495139347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++ + +++G+g+W++I+r+   ++t+ q+ s+ qky
       EPS70087.1  95 PWTEDEHQLFLMGLHRYGKGDWRSISRYYVITKTPTQVASHAQKY 139
                      8*****************************889***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.031149IPR017877Myb-like domain
SMARTSM007170.5151IPR001005SANT/Myb domain
SuperFamilySSF466896.39E-7255IPR009057Homeodomain-like
PROSITE profilePS5129419.76688144IPR017930Myb domain
SuperFamilySSF466896.89E-1690143IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-1792143IPR006447Myb domain, plants
SMARTSM007171.1E-1192142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-1094141IPR009057Homeodomain-like
CDDcd001671.20E-995140No hitNo description
PfamPF002492.7E-1395139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
SCWSSEENKL FENALAELQP DSPGFFETLA SCVPWKPIND ITSHYQSLLR DVEMIESDLY  60
PVPKYTDSVK KDHVEEAISN GKRTKKGRDR RRGVPWTEDE HQLFLMGLHR YGKGDWRSIS  120
RYYVITKTPT QVASHAQKYF RRQTCSTPAE KRRPSIHDIQ TTPN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098014.11e-76PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-49DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLS8EBY71e-122S8EBY7_9LAMI; Uncharacterized protein (Fragment)
STRINGGRMZM2G056986_P012e-50(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52342032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.17e-46Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]