PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS70032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 147aa    MW: 16136.1 Da    PI: 10.2063
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS70032.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.2e-181661147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd ll ++v++ G+++W++I++ ++ gR++k+c++rw + 
       EPS70032.1 16 KGPWSPEEDGLLRRLVEKQGPRNWSLISKSIP-GRSGKSCRLRWCNQ 61
                     79******************************.***********985 PP

2Myb_DNA-binding50.54.8e-1670112347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd  +++a+ +lG++ W++Iar +  gRt++ +k++w++ 
       EPS70032.1  70 AFTAEEDATIIRAHGELGNK-WAAIARLLS-GRTDNAIKNHWNST 112
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6861166IPR017930Myb domain
SuperFamilySSF466894.67E-3114109IPR009057Homeodomain-like
SMARTSM007172.2E-151564IPR001005SANT/Myb domain
PfamPF002493.8E-181661IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-261769IPR009057Homeodomain-like
CDDcd001671.37E-141860No hitNo description
SMARTSM007172.4E-1367115IPR001005SANT/Myb domain
PROSITE profilePS5129419.94468117IPR017930Myb domain
CDDcd001671.44E-1070113No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2270116IPR009057Homeodomain-like
PfamPF002497.4E-1470112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
FSGMAARKEE SSERAKGPWS PEEDGLLRRL VEKQGPRNWS LISKSIPGRS GKSCRLRWCN  60
QLSPAVEHRA FTAEEDATII RAHGELGNKW AAIARLLSGR TDNAIKNHWN STLKRKCGAS  120
STSSSDEFCA FDADAPPPIK RAASFGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-40131171105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074411.19e-73PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-62MYB44_ARATH; Transcription factor MYB44
TrEMBLS8EBT91e-104S8EBT9_9LAMI; Myb-like protein (Fragment)
STRINGVIT_18s0001g09850.t011e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-66myb domain protein 73
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]