PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS69741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 248aa    MW: 28056.8 Da    PI: 10.024
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS69741.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-1765111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg WT++Ede l++av+ + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
       EPS69741.1  65 RGGWTPDEDETLKNAVAAHKGKSWKKIAEFFP-CRTEVQCLHRWQKVL 111
                      789*****************************.************986 PP

2Myb_DNA-binding63.54.2e-20117163148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT eEde++v+ v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
       EPS69741.1 117 KGPWTLEEDEKIVEMVAKHGPTKWSVIAKSLP-GRIGKQCRERWHNHL 163
                      79******************************.*************97 PP

3Myb_DNA-binding52.31.3e-16169212146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++W+ eE++ l++a++ +G++ W+  a+ ++ gRt++ +k++w++
       EPS69741.1 169 KDAWSLEEELTLLNAHRVHGNK-WAELAKLLP-GRTDNAIKNHWNS 212
                      689*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.68560111IPR017930Myb domain
SMARTSM007172.4E-1364113IPR001005SANT/Myb domain
PfamPF002491.3E-1565111IPR001005SANT/Myb domain
SuperFamilySSF466893.88E-1566121IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-2167118IPR009057Homeodomain-like
CDDcd001671.05E-1168111No hitNo description
PROSITE profilePS5129431.248112167IPR017930Myb domain
SuperFamilySSF466891.34E-31114210IPR009057Homeodomain-like
SMARTSM007173.5E-18116165IPR001005SANT/Myb domain
PfamPF002496.0E-19117163IPR001005SANT/Myb domain
CDDcd001672.43E-15119163No hitNo description
Gene3DG3DSA:1.10.10.602.8E-27119166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-22167218IPR009057Homeodomain-like
SMARTSM007177.0E-15168216IPR001005SANT/Myb domain
PROSITE profilePS5129420.61168218IPR017930Myb domain
PfamPF002497.0E-15169212IPR001005SANT/Myb domain
CDDcd001672.25E-10171214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
LLMDVVESED PYPNQKESAT TLSSSVSENS SDFAAKSPGI SSPASTSPSR SMIERRTTGP  60
IRRARGGWTP DEDETLKNAV AAHKGKSWKK IAEFFPCRTE VQCLHRWQKV LNPELIKGPW  120
TLEEDEKIVE MVAKHGPTKW SVIAKSLPGR IGKQCRERWH NHLNPEIKKD AWSLEEELTL  180
LNAHRVHGNK WAELAKLLPG RTDNAIKNHW NSSLKKKLDF YLVTGNLPQV PRSNTENGNR  240
DNLRRTAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-72682189159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-72682189159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003623113.11e-126myb transcription factor
RefseqXP_013448854.11e-126myb transcription factor
RefseqXP_014492068.11e-126PREDICTED: myb-related protein 3R-1
SwissprotQ9S7G74e-84MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLS8CXI40.0S8CXI4_9LAMI; Uncharacterized protein (Fragment)
STRINGGLYMA18G39740.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54612437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-108myb domain protein 3r-5
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]