PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS69726.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family ARF
Protein Properties Length: 583aa    MW: 65389.1 Da    PI: 7.9731
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS69726.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.91.1e-241062091100
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+kvltpsd++++g +++ +k+a+e+       +  +  s++l+ +d++g +W +k+i r++++r++lt+GW+ Fv +++L +gD++vF + g +++el
  EPS69726.1 106 FCKVLTPSDTSTHGGFSVLRKHASEClppldmsQ--QIPSQELIAKDLHGIEWHFKHILRGQPRRHLLTTGWSTFVTSKRLIAGDSFVFLRGG-ETGEL 201
                 99****************************9543..445679************************************************655.9999* PP

                 EEEEE-SS CS
          B3  93 vvkvfrks 100
                 +v+v+r+s
  EPS69726.1 202 RVGVRRHS 209
                 *****985 PP

2Auxin_resp99.25.9e-33233312183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+ t+++F v+Y+Pr+  s+F+++++k+++a+++ + vGmRfkm+fe eds+e+r+sGt+vgv+d++p  W++SkWr Lk
  EPS69726.1 233 ASHAVLTQTIFVVYYKPRV--SQFIISLNKYLEAMNQDLGVGMRFKMRFEVEDSPEKRFSGTIVGVEDVSP-CWEDSKWRTLK 312
                 68999*************7..9*************************************************.9*******996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.46E-3797236IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-3898222IPR015300DNA-binding pseudobarrel domain
CDDcd100175.18E-22104207No hitNo description
PROSITE profilePS5086311.956106209IPR003340B3 DNA binding domain
PfamPF023621.3E-22106208IPR003340B3 DNA binding domain
SMARTSM010196.3E-23106209IPR003340B3 DNA binding domain
PfamPF065074.3E-30233312IPR010525Auxin response factor
PfamPF023091.8E-6504553IPR033389AUX/IAA domain
PROSITE profilePS5174521.863517583IPR000270PB1 domain
SuperFamilySSF542771.37E-9521583No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
LYEELWKACA GPLVEVPRVG ERVYYFPQGH MEQLEASTNQ ELSQRIPMFN LPPKILCRVF  60
NIQLLAEQET DEVYAQITLM PEADQTEPKS PDSYPDEPSR PVVHSFCKVL TPSDTSTHGG  120
FSVLRKHASE CLPPLDMSQQ IPSQELIAKD LHGIEWHFKH ILRGQPRRHL LTTGWSTFVT  180
SKRLIAGDSF VFLRGGETGE LRVGVRRHSN TQSSMPSSVI SSQSMHLGVL ATASHAVLTQ  240
TIFVVYYKPR VSQFIISLNK YLEAMNQDLG VGMRFKMRFE VEDSPEKRFS GTIVGVEDVS  300
PCWEDSKWRT LKVQWDEPAS ISRPERVSPW EIQPFVSPAP LSVLHPLPVK HKRIRSQIET  360
PVSGKACYCI MSPFDSNFSF RHFSQRSNSI VKKTDLGTAS ANHCSNNSNN SSTHIDAAST  420
LANAPPPSIP HESEEAKSGS AWSVVTDLSK IPGNSPSSKL HTATPPCRLF GIDLNRPSCA  480
EKTRLRSNSS SSSRTRTKVI NNSSLSYFYK KTPHITFSKK KVQMQGVAVG RAVDLNSLKG  540
YDDLITELEE MFEIRGELRP RSKWEIVYTD NEGDTMLAGD DPW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-177133719357Auxin response factor 1
4ldw_A1e-177133719357Auxin response factor 1
4ldw_B1e-177133719357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082305.10.0auxin response factor 9
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLS8CXH20.0S8CXH2_9LAMI; Auxin response factor (Fragment)
STRINGMigut.A00611.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  3. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]