PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS69353.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 210aa    MW: 23511.1 Da    PI: 7.7157
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS69353.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.4e-082469245
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     grWT  E + + +a +++  +   +W ++a++++ g+t  ++   + 
       EPS69353.1 24 GRWTVAENKAFENALALYDENtpdRWQRVAEMVP-GKTVADVMRQYK 69
                     8*********************************.****99988875 PP

2Myb_DNA-binding47.83.3e-15131175347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
       EPS69353.1 131 PWTEEEHKLFLMGLKKHGKGDWRNISRNFVITRTPTQVASHAQKY 175
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.2952174IPR017884SANT domain
SMARTSM007172.0E-92274IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-42470IPR009057Homeodomain-like
SuperFamilySSF466892.08E-112479IPR009057Homeodomain-like
PfamPF002491.9E-62469IPR001005SANT/Myb domain
CDDcd001671.99E-72571No hitNo description
Gene3DG3DSA:1.10.10.604.6E-13122180IPR009057Homeodomain-like
PROSITE profilePS5129421.643124180IPR017930Myb domain
SuperFamilySSF466894.79E-17126179IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-17127179IPR006447Myb domain, plants
SMARTSM007173.3E-13128178IPR001005SANT/Myb domain
CDDcd001672.02E-11131176No hitNo description
PfamPF002491.3E-13131175IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MEILSPASSY CFSNSSWLAA EDEGRWTVAE NKAFENALAL YDENTPDRWQ RVAEMVPGKT  60
VADVMRQYKE LEDDVSSIEA GLFPFQGYAA DSSPFTLDWG GGGGANFKAA YAPSGGRRSR  120
SSDHERKKGV PWTEEEHKLF LMGLKKHGKG DWRNISRNFV ITRTPTQVAS HAQKYFIRQL  180
SGGKDKRRAS IHDITTLNLD QTQTTTLNNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-1626881173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080854.11e-102PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-104DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLS8E1741e-158S8E174_9LAMI; Uncharacterized protein (Fragment)
STRINGBra006741.1-P1e-100(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.14e-93MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]