PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS68923.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 203aa    MW: 22947.2 Da    PI: 10.7782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS68923.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed ll d++++ G g+W++ ++  g+ R++k+c++rw +yl
       EPS68923.1 14 RGPWSEKEDALLTDYINRNGEGQWRSLPKNAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding475.8e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+  ++E++l+v+++ +lG++ W++Ia +++ gRt++++k++w+++
       EPS68923.1  67 RGNIGEDEEDLIVHLHGLLGNR-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      677789****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.914961IPR017930Myb domain
SuperFamilySSF466891.31E-2711108IPR009057Homeodomain-like
SMARTSM007171.8E-111363IPR001005SANT/Myb domain
PfamPF002497.0E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-211568IPR009057Homeodomain-like
CDDcd001675.46E-91661No hitNo description
PROSITE profilePS5129422.86162116IPR017930Myb domain
SMARTSM007171.2E-1266114IPR001005SANT/Myb domain
PfamPF002493.8E-1367111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-2369116IPR009057Homeodomain-like
CDDcd001676.41E-1072112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGRSPCCSKV GLRRGPWSEK EDALLTDYIN RNGEGQWRSL PKNAGLLRCG KSCRLRWMNY  60
LRPGIKRGNI GEDEEDLIVH LHGLLGNRWS LIAGRLPGRT DNEIKNYWNT HIVKKLQSSG  120
IHLRPHSGFP RPPLPPPAKE PPQVKRSKKR QRKSPPEKED DEQGPPRTVV HRPKPIRISA  180
PAPSLPRLNS WDSYPSVGSS DAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25121185110B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144152KRSKKRQRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070362.11e-85PREDICTED: transcription repressor MYB5-like
SwissprotQ9S9K92e-62MYB3_ARATH; Transcription factor MYB3
TrEMBLS8DZZ21e-146S8DZZ2_9LAMI; Myb transcription factor (Fragment)
STRINGSolyc08g082890.2.18e-80(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.12e-62myb domain protein 3
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]