PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS68836.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family VOZ
Protein Properties Length: 447aa    MW: 49467.1 Da    PI: 5.1512
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS68836.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ379.21.2e-1161824071217
         VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                 pppsaflgpkcalwdc+rpa   +w q   dycs++ha la  eg  g  p++rp+gi+lkd+llfaal ak+ gk+vgipecegaatakspwna+elf
  EPS68836.1 182 PPPSAFLGPKCALWDCPRPAFCLDWSQktnDYCSMYHAGLASSEGYRGRPPIVRPGGIGLKDNLLFAALDAKATGKDVGIPECEGAATAKSPWNAPELF 280
                 89*******************9999754449******************************************************************** PP

         VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineld...alalyrlelklvde 192
                 d+ +lege++rew+ffdk rrafesgnrkqrslpdy+grgwhesrkqvm+e gglkrsyymdpqp++ fewhlyeyei+  d   ++alyrle+k +d+
  EPS68836.1 281 DVGVLEGESMREWVFFDKARRAFESGNRKQRSLPDYNGRGWHESRKQVMNEVGGLKRSYYMDPQPMERFEWHLYEYEIKRPDcdcSCALYRLEVKRADG 379
                 ******************************************************************************975533569************ PP

         VOZ 193 kksakgkvs...kdsladlqkklgrlta 217
                 kks+kgk+s   ++ +adlqk++ +l+a
  EPS68836.1 380 KKSPKGKLSlssNECIADLQKQMRKLSA 407
                 *******862226789*********987 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MVKGSKTSDC KSASHQHFKD RAKNLVDDLQ GMFINLQSAR KESRSIDVAV LEEQVHQMLR  60
EWKAELNEVS PASSLQQGGS LGFSSDICRL LHLYEEEDDA TSALAAPKSE PDAHNIADGS  120
NPKEQGNDLG VANMAGSDEV PSESQLDFHP FEFQSDFEQQ FISSGYPGSG FGGQYGYDQI  180
FPPPSAFLGP KCALWDCPRP AFCLDWSQKT NDYCSMYHAG LASSEGYRGR PPIVRPGGIG  240
LKDNLLFAAL DAKATGKDVG IPECEGAATA KSPWNAPELF DVGVLEGESM REWVFFDKAR  300
RAFESGNRKQ RSLPDYNGRG WHESRKQVMN EVGGLKRSYY MDPQPMERFE WHLYEYEIKR  360
PDCDCSCALY RLEVKRADGK KSPKGKLSLS SNECIADLQK QMRKLSADGK GRGKVSSGGS  420
PVPSPNPTAQ GFDYLVEDVD NGYYNVT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096373.20.0transcription factor VOZ1, partial
SwissprotQ9SGQ01e-175VOZ1_ARATH; Transcription factor VOZ1
TrEMBLS8CVB20.0S8CVB2_9LAMI; Uncharacterized protein
STRINGMigut.M01093.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-149vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  5. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]