PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS68758.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 116aa    MW: 13533.8 Da    PI: 10.7247
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS68758.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +lvd +   G ++W+ +++  g+ R++k+c++rw +yl
       EPS68758.1 14 RGSWTSEEDSKLVDFILNNGIPSWRMVPKLAGLMRCGKSCRLRWMNYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.32.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T  E++ +++++ +lG++ W++Ia++++ gRt++++k+ w++
       EPS68758.1  67 RGGFTDAEEDMIIQLHSKLGNR-WSKIASHFP-GRTDNEIKNQWNT 110
                      788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.917961IPR017930Myb domain
SuperFamilySSF466895.24E-2911108IPR009057Homeodomain-like
SMARTSM007171.2E-71363IPR001005SANT/Myb domain
PfamPF002494.6E-121461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-211568IPR009057Homeodomain-like
CDDcd001677.69E-71661No hitNo description
PROSITE profilePS5129424.74162116IPR017930Myb domain
SMARTSM007176.3E-1666114IPR001005SANT/Myb domain
PfamPF002496.6E-1567110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-2769116IPR009057Homeodomain-like
CDDcd001673.35E-1170110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MGRQPCCEKV GLRRGSWTSE EDSKLVDFIL NNGIPSWRMV PKLAGLMRCG KSCRLRWMNY  60
LRPDLKRGGF TDAEEDMIIQ LHSKLGNRWS KIASHFPGRT DNEIKNQWNT RIKKKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071180.13e-71PREDICTED: protein ODORANT1
SwissprotP800732e-62MYB2_PHYPA; Myb-related protein Pp2
TrEMBLS8DZI23e-82S8DZI2_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0001s36220.15e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.11e-69myb domain protein 40
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]