PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS68222.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 725aa    MW: 82131.1 Da    PI: 8.4899
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS68222.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.8e-141156248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
       EPS68222.1 11 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 56
                     78*****************************.************986 PP

2Myb_DNA-binding33.31.1e-1063106248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
       EPS68222.1  63 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 106
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008560IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-18859IPR009057Homeodomain-like
SMARTSM007177.0E-15958IPR001005SANT/Myb domain
CDDcd001675.28E-121356No hitNo description
PfamPF139213.3E-131373No hitNo description
SuperFamilySSF466897.55E-2136110IPR009057Homeodomain-like
CDDcd116591.21E-3058109No hitNo description
Gene3DG3DSA:1.10.10.602.3E-1460107IPR009057Homeodomain-like
PROSITE profilePS5129416.44361110IPR017930Myb domain
SMARTSM007171.7E-1261108IPR001005SANT/Myb domain
PfamPF118317.2E-52409653IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
VAKMRIMIKG GVWKNTEDEI LKAAVMKYGK NQWARISSLL VRKSAKQCKA RWYEWLDPSI  60
KKTEWTREED EKLLHLAKLM PTQWRTIAPI VGRTPSQCLE RYEKLLDAAC AKDENYEPGD  120
DPRKLRPGEI DPNPESKPAR PDPVDMDEDE KEMLSEARAR LANTRGKKAK RKAREKQLEE  180
ARRLASLQKR RELKAAGMHV RHRKKKRKGI DYNAEIPFEK RPPPGFYDVA EEDRPAEYIR  240
FPTTIQDLEG ERRVDKESRL RKQDIAKNRI AQRQDAPSAI LQANKLNDPE SVRKRSRLNL  300
PAPQIPDHEL EAIAKIGIAS DMINHDELTE GSAATRALLA SYAQTPQIGM TPLRTPQRTP  360
AGKQDAIMME AENQRRLTLS QTPLLGGENP ILHPSDFSGV TPRKKDIATP NLLLTPSATP  420
GGITPRVGMT PSRDGYSFGV TPKATPMRDE LRINEGPDVG DNGKSRQSEL KKELISGLKS  480
LPQPKNEYQF VIQPLLEENE EQEEKIEEDM SDRLAIEKAE EAARQQELLK KRSKVLQREE  540
LPRPPAASVD LIRDSLTRAV EDKSSFVPPT LLEQADELIR RELLSLLEHD NAKYPLDENS  600
GKEKRKGGKR VSNGKSGPVP SIDDFEETEL NEADELVKKE SESIRSAMGH DGESPAEYIE  660
AHQTCLNDMM YFPTRDGYGL SSVANNAEKL AALQSEFDNV KRKMDDETKK AQKHEQKLKV  720
LTNGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10462272236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188207KRRELKAAGMHVRHRKKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084262.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLS8E7300.0S8E730_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc04g009950.2.10.0(Solanum lycopersicum)
STRINGPGSC0003DMT4000299530.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61392431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]