PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS67924.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 210aa    MW: 24176.7 Da    PI: 11.1181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS67924.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-18350148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+d+++++G g+W++ +++ g+ R++k+c++rw +yl
       EPS67924.1  3 KGPWTREEDQKLLDYIQKHGHGSWRSLPSKAGLQRCGKSCRLRWTNYL 50
                     79********************************************97 PP

2Myb_DNA-binding52.61e-165699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+++t E++ +++++++lG++ W++Ia++++ +Rt++++k++w++
       EPS67924.1 56 RGKFSTHEEKMIIRLHALLGNR-WSAIAAHLP-KRTDNEIKNYWNT 99
                     89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.504154IPR017930Myb domain
SMARTSM007175.7E-14252IPR001005SANT/Myb domain
SuperFamilySSF466892.31E-30297IPR009057Homeodomain-like
PfamPF002491.2E-16350IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-24457IPR009057Homeodomain-like
CDDcd001674.61E-11550No hitNo description
SMARTSM007175.8E-1655103IPR001005SANT/Myb domain
PROSITE profilePS5129418.73955105IPR017930Myb domain
PfamPF002493.4E-155699IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2658105IPR009057Homeodomain-like
CDDcd001676.62E-1158101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
LKKGPWTREE DQKLLDYIQK HGHGSWRSLP SKAGLQRCGK SCRLRWTNYL RPDIKRGKFS  60
THEEKMIIRL HALLGNRWSA IAAHLPKRTD NEIKNYWNTR LKKRLTRMGI DPATHKPKIV  120
NGHQSNPKHA ANINHMAQWE TARLEAEARL ARESKLRSCR LLNHNGIAHA QPQPPPCLDV  180
LRVWRATSAS NCFFNSPTTL ESPTSTLNFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2911055108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075642.11e-106PREDICTED: transcription factor MYB28-like
SwissprotQ9SPG23e-62MYB28_ARATH; Transcription factor MYB28
TrEMBLS8CLA71e-156S8CLA7_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0008s08870.12e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.19e-76myb domain protein 106
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]