PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS67829.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 187aa    MW: 21262.1 Da    PI: 8.7792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS67829.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-17651147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W +eEd  l ++v+++G+++W++I+  ++ gR++k+c++rw + 
       EPS67829.1  6 KGSWNPEEDAALMRLVAEHGPRDWSLISTGIP-GRSGKSCRLRWCNQ 51
                     799*****************************.***********985 PP

2Myb_DNA-binding482.9e-1560102347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T  Ed  + +a++ +G++ W++Iar ++ gRt++ +k++w++ 
       EPS67829.1  60 PFTLAEDAVIERAHAVHGNR-WAAIARLLP-GRTDNAVKNHWNST 102
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.457156IPR017930Myb domain
SuperFamilySSF466893.29E-29399IPR009057Homeodomain-like
SMARTSM007173.1E-15554IPR001005SANT/Myb domain
PfamPF002493.0E-17651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-22758IPR009057Homeodomain-like
CDDcd001672.51E-13850No hitNo description
SMARTSM007171.1E-1357105IPR001005SANT/Myb domain
PROSITE profilePS5129420.16757107IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2159106IPR009057Homeodomain-like
PfamPF002497.2E-1360102IPR001005SANT/Myb domain
CDDcd001672.85E-1060103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MERKIKGSWN PEEDAALMRL VAEHGPRDWS LISTGIPGRS GKSCRLRWCN QLSPAVHHRP  60
FTLAEDAVIE RAHAVHGNRW AAIARLLPGR TDNAVKNHWN STLKRKKNTW DEPLLLGLKR  120
RQCSRAAQEP DGPALNLFPG KRWEREDDES KDLNGDTCLV TIIRKIIAQE VRNYMNQLSA  180
CGEEDDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-3651096110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084888.12e-72PREDICTED: transcriptional activator Myb-like
SwissprotQ9FDW16e-52MYB44_ARATH; Transcription factor MYB44
TrEMBLS8CL421e-137S8CL42_9LAMI; Uncharacterized protein
STRINGVIT_13s0067g01360.t013e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128831620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.13e-53myb domain protein r1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]