PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS67776.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 111aa    MW: 13067.2 Da    PI: 11.0089
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS67776.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41.1e-15754148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed+ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
       EPS67776.1  7 KGAWTKYEDDLLRECIGKHGEGKWHMVPIRAGLNRCRKSCRLRWLNYL 54
                     79*********************************************7 PP

2Myb_DNA-binding44.14.9e-1460107147
                      TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47 
                      rg ++++E +ll++++k+lG++   W++Ia +++  Rt++++k++w+++
       EPS67776.1  60 RGTFSEDEVDLLLRLHKLLGNRlvLWSLIAGRLP-DRTANDVKNFWNSH 107
                      899*******************************.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.671258IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-21357IPR009057Homeodomain-like
SuperFamilySSF466899.19E-264104IPR009057Homeodomain-like
SMARTSM007179.3E-12656IPR001005SANT/Myb domain
PfamPF002492.2E-14754IPR001005SANT/Myb domain
CDDcd001674.70E-8954No hitNo description
Gene3DG3DSA:1.10.10.605.7E-2158111IPR009057Homeodomain-like
PROSITE profilePS5129417.3659111IPR017930Myb domain
SMARTSM007171.5E-1059110IPR001005SANT/Myb domain
PfamPF002493.0E-1360107IPR001005SANT/Myb domain
CDDcd001675.56E-485107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
SSRGVRKGAW TKYEDDLLRE CIGKHGEGKW HMVPIRAGLN RCRKSCRLRW LNYLRPNIKR  60
GTFSEDEVDL LLRLHKLLGN RLVLWSLIAG RLPDRTANDV KNFWNSHCKK K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2171117107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306786.12e-57transcription factor MYB114-like
RefseqXP_006602928.12e-57PREDICTED: transcription factor MYB114-like
RefseqXP_009605381.12e-57PREDICTED: transcription factor MYB114-like
RefseqXP_009627993.12e-57PREDICTED: transcription factor MYB114-like
RefseqXP_011100106.13e-57PREDICTED: transcription factor MYB90-like
RefseqXP_016468884.12e-57PREDICTED: transcription factor MYB114-like
SwissprotQ9FNV98e-55MY113_ARATH; Transcription factor MYB113
TrEMBLS8CSC42e-76S8CSC4_9LAMI; Anthocyanin 2 (Fragment)
STRINGGLYMA18G49690.17e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66380.12e-52myb domain protein 114
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]