PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS67448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family LFY
Protein Properties Length: 121aa    MW: 13459.4 Da    PI: 9.5369
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS67448.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY240.21e-731106281386
     FLO_LFY 281 vtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLCh 379
                 vtnqvfr+akkaga+yinkPkmrhYvhCYalhcLde++s+alrrafkergenvGawrqacykplvaiaa q+wdida+f++hprLs+WYvPtkLrqLCh
  EPS67448.1   1 VTNQVFRFAKKAGANYINKPKMRHYVHCYALHCLDEDTSDALRRAFKERGENVGAWRQACYKPLVAIAAAQAWDIDAIFSSHPRLSVWYVPTKLRQLCH 99 
                 9************************************************************************************************** PP

     FLO_LFY 380 lerskas 386
                 +ers+a+
  EPS67448.1 100 AERSAAA 106
                 ***9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.5E-711106IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
VTNQVFRFAK KAGANYINKP KMRHYVHCYA LHCLDEDTSD ALRRAFKERG ENVGAWRQAC  60
YKPLVAIAAA QAWDIDAIFS SHPRLSVWYV PTKLRQLCHA ERSAAAAAAS ASSVTAADHM  120
P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A3e-64110359161PROTEIN LEAFY
2vy2_A3e-64110359161PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310806.13e-71floricaula/leafy homolog
RefseqXP_023873133.11e-72protein UNIFOLIATA-like, partial
SwissprotO485592e-68UNI_PEA; Protein UNIFOLIATA
TrEMBLS8DWA12e-84S8DWA1_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_008392692.12e-70(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.13e-57floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]