PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS67033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 133aa    MW: 15529.5 Da    PI: 9.3257
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS67033.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-162570147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l+++v+ +G+ +W++Ia+++  gR++k+c++rw++ 
       EPS67033.1 25 RGHWRPAEDAKLKELVAIFGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 70
                     899*****************************.***********996 PP

2Myb_DNA-binding58.81.2e-1877120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l  a++++G++ W+ Iar ++ gRt++ +k++w+ 
       EPS67033.1  77 RRAFTEEEEERLMAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 120
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9562071IPR017930Myb domain
SMARTSM007178.4E-142473IPR001005SANT/Myb domain
SuperFamilySSF466896.74E-2924118IPR009057Homeodomain-like
PfamPF002495.4E-162570IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-272678IPR009057Homeodomain-like
CDDcd001675.96E-122869No hitNo description
PROSITE profilePS5129427.28872126IPR017930Myb domain
SMARTSM007172.1E-1476124IPR001005SANT/Myb domain
PfamPF002494.0E-1577119IPR001005SANT/Myb domain
CDDcd001679.42E-1179119No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2179125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
NPEEDQDPAV PMHGCDGGGS KHCARGHWRP AEDAKLKELV AIFGPQNWNL IAEKLEGRSG  60
KSCRLRWFNQ LDPRINRRAF TEEEEERLMA AHRLYGNKWA MIARLFPGRT DNAVKNHWHV  120
IMARKYREQQ QQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-34191261108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001307310.12e-75R2R3MYB transcription factor 117
RefseqXP_015075753.12e-75PREDICTED: transcription factor MYB86
SwissprotQ9FDW15e-38MYB44_ARATH; Transcription factor MYB44
TrEMBLS8DV426e-97S8DV42_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc05g007870.1.15e-75(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16842470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-73myb domain protein 105
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]