PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS66626.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 130aa    MW: 14908.3 Da    PI: 10.5808
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS66626.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+++v + G+g tW + ++++g++R++k+c++rw++yl
       EPS66626.1 14 RGPWSPEEDSKLKEYVSKNGTGgTWIALPQKVGLKRCGKSCRLRWLNYL 62
                     89**********************************************7 PP

2Myb_DNA-binding39.31.5e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd ++ ++ +  G++ W+  a++++ gRt++++k++w++
       EPS66626.1  69 GEFSDEEDRIIFNLYATIGSR-WSIMAARLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.936966IPR017930Myb domain
SuperFamilySSF466894.79E-2711109IPR009057Homeodomain-like
SMARTSM007171.6E-111364IPR001005SANT/Myb domain
PfamPF002492.0E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231569IPR009057Homeodomain-like
CDDcd001678.29E-81662No hitNo description
SMARTSM007171.6E-1267115IPR001005SANT/Myb domain
PROSITE profilePS5129415.70267117IPR017930Myb domain
PfamPF002492.6E-1169111IPR001005SANT/Myb domain
CDDcd001671.23E-870113No hitNo description
Gene3DG3DSA:1.10.10.605.0E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MGRAPCCARA SVKRGPWSPE EDSKLKEYVS KNGTGGTWIA LPQKVGLKRC GKSCRLRWLN  60
YLRPNLKHGE FSDEEDRIIF NLYATIGSRW SIMAARLPGR TDNDIKNYWN TKLKKKLLIG  120
IPRPNDINFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010101625.17e-75Transcription factor RAX2
SwissprotQ9FKL25e-72MYB36_ARATH; Transcription factor MYB36
TrEMBLS8CP651e-92S8CP65_9LAMI; Uncharacterized protein (Fragment)
STRINGSi030544m2e-72(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-73myb domain protein 36
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]