PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS66506.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family S1Fa-like
Protein Properties Length: 69aa    MW: 7663.31 Da    PI: 10.6884
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS66506.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA137.23.8e-43569670
        S1FA  6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                 e+kG nPGlivllv+gglll+flvgny+ly+yaqknlPP+kkkPvskkk+kre+lkqGv++PGe
  EPS66506.1  5 GEVKGYNPGLIVLLVIGGLLLLFLVGNYVLYIYAQKNLPPKKKKPVSKKKMKRERLKQGVSAPGE 69
                599*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046892.6E-40669IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
LIENGEVKGY NPGLIVLLVI GGLLLLFLVG NYVLYIYAQK NLPPKKKKPV SKKKMKRERL  60
KQGVSAPGE
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.21e-26DNA-binding protein S1FA
RefseqXP_024026346.11e-26DNA-binding protein S1FA
SwissprotQ423374e-15S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLS8CNW92e-38S8CNW9_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_010104121.14e-26(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31742249
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]