PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS66328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 131aa    MW: 15129.5 Da    PI: 10.1694
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS66328.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+lv+ ++++G g+W+++++  g+ R++k+c++rw +yl
       EPS66328.1 14 KGLWSPEEDEKLVNHITKYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding47.73.7e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg +++eE+ l+++++  lG++ W+ Ia+ ++ gRt++++k+ w+
       EPS66328.1  67 RGTFSPEEESLIIELHSVLGNR-WSQIAAQLP-GRTDNEIKNLWN 109
                      899*******************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-28664IPR009057Homeodomain-like
PROSITE profilePS5129424.898965IPR017930Myb domain
SuperFamilySSF466896.11E-3112108IPR009057Homeodomain-like
SMARTSM007175.6E-131363IPR001005SANT/Myb domain
PfamPF002494.1E-161461IPR001005SANT/Myb domain
CDDcd001674.02E-111761No hitNo description
Gene3DG3DSA:1.10.10.605.7E-2665116IPR009057Homeodomain-like
SMARTSM007178.0E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.39366116IPR017930Myb domain
PfamPF002495.6E-1467109IPR001005SANT/Myb domain
CDDcd001675.40E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLVNHIT KYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SPEEESLIIE LHSVLGNRWS QIAAQLPGRT DNEIKNLWNS SIKKKMRNMG  120
IDPSTHKPLS E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-32121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009762834.13e-87PREDICTED: transcription factor MYB86-like
RefseqXP_011087570.13e-87PREDICTED: transcription factor MYB86-like
RefseqXP_016436036.13e-87PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH67e-82MYB86_ARATH; Transcription factor MYB86
TrEMBLS8DT679e-94S8DT67_9LAMI; Uncharacterized protein (Fragment)
STRINGBra030783.1-P7e-85(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-86myb domain protein 61
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]