PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS66301.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 463aa    MW: 52949.6 Da    PI: 8.9399
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS66301.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.23.2e-07110201146
                      TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqk 46 
                      rg W+teE e l ++vkq   g                                              +W+ +a++   gRt+++c+sr+++
       EPS66301.1 110 RGIWSTEERENLGKGVKQQFQGmllqrsldvlseedgsensgnidhvmlsikdvnitpegmrsflpkvNWEQVAAMYVPGRTGEECQSRFLN 201
                      788****************999*****************************************************9999***********98 PP

2Myb_DNA-binding28.82.8e-09209254146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++WT  Ed+ l++  +q G  +W  Ia+ +g+ Rt+ qc  r+q 
       EPS66301.1 209 RDPWTVTEDKNLLHILQQRGLSNWIEIAALLGTSRTPSQCLARYQR 254
                      789*****************************************96 PP

3Myb_DNA-binding47.44.3e-15263308248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        W+++Ed+ l  av+ +G g+W ++a+ m  gRt+ qc +rw+k l
       EPS66301.1 263 RDWSPQEDDDLRAAVETYGEGNWQLVAAAME-GRTGTQCSNRWLKTL 308
                      57*****************************.***********9975 PP

4Myb_DNA-binding61.12.3e-19316360247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+W++eEd++l+ av++lG++tWk+Ia++++ gRt  qc++rw + 
       EPS66301.1 316 GKWSAEEDKRLKVAVTLLGPKTWKKIASCVP-GRTQVQCRERWVNC 360
                      79*****************************.***********986 PP

5Myb_DNA-binding46.21.1e-14369409345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +W+ eEd +l +a++++G   W+++a++++ +Rt+++c  rw 
       EPS66301.1 369 KWSREEDMKLEEAIALHGHC-WSKVAACIP-NRTDNHCWRRWK 409
                      8*****************99.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0059109205IPR001005SANT/Myb domain
PROSITE profilePS500905.645110201IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.0E-10112128IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-10176216IPR009057Homeodomain-like
SuperFamilySSF466891.65E-17184257IPR009057Homeodomain-like
PROSITE profilePS500909.593204256IPR017877Myb-like domain
SMARTSM007171.0E-6208258IPR001005SANT/Myb domain
PfamPF002494.7E-8209254IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-11217265IPR009057Homeodomain-like
SuperFamilySSF466891.15E-18242311IPR009057Homeodomain-like
PROSITE profilePS5129414.995257308IPR017930Myb domain
SMARTSM007179.3E-14261310IPR001005SANT/Myb domain
PfamPF002496.5E-14263307IPR001005SANT/Myb domain
CDDcd001671.12E-10265308No hitNo description
Gene3DG3DSA:1.10.10.605.5E-17266310IPR009057Homeodomain-like
PROSITE profilePS5129422.317309365IPR017930Myb domain
SuperFamilySSF466893.22E-26313408IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-19314363IPR009057Homeodomain-like
SMARTSM007171.2E-14314363IPR001005SANT/Myb domain
PfamPF002491.6E-16316360IPR001005SANT/Myb domain
CDDcd001671.56E-11317359No hitNo description
Gene3DG3DSA:1.10.10.603.1E-16364411IPR009057Homeodomain-like
SMARTSM007177.4E-11366414IPR001005SANT/Myb domain
PROSITE profilePS5129415.322368416IPR017930Myb domain
CDDcd001673.31E-9369412No hitNo description
PfamPF002495.8E-13369409IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
PNSAHAFVDA INENRSYQKL IRNKMMQLEA MIEELEKITE HVKILKDFQV ACKKRTGRAL  60
SQKRDARMQL IALPKPRPKY KSTHKGPPEN PHVAKFRKGM EAFGIFSISR GIWSTEEREN  120
LGKGVKQQFQ GMLLQRSLDV LSEEDGSENS GNIDHVMLSI KDVNITPEGM RSFLPKVNWE  180
QVAAMYVPGR TGEECQSRFL NCEDPLINRD PWTVTEDKNL LHILQQRGLS NWIEIAALLG  240
TSRTPSQCLA RYQRSLNASM LKRDWSPQED DDLRAAVETY GEGNWQLVAA AMEGRTGTQC  300
SNRWLKTLNP TRQRVGKWSA EEDKRLKVAV TLLGPKTWKK IASCVPGRTQ VQCRERWVNC  360
LNPSLNLSKW SREEDMKLEE AIALHGHCWS KVAACIPNRT DNHCWRRWKA LFPDEVVEVE  420
EARKIQKCAL ISNFVDREWE RPALGPADFV MPEKCAVGKS SET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-291814162159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-291814162159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084456.10.0PREDICTED: uncharacterized protein LOC105166700
TrEMBLS8CNE10.0S8CNE1_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc03g119050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA108762124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-165myb domain protein 4r1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]