PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS66172.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 119aa    MW: 14035 Da    PI: 9.8698
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS66172.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l  +++++G  +W++ +++ g+ R++k+c++rw++yl
       EPS66172.1 14 KGAWTEEEDEKLRAYIQRYGHWNWNLLPKYAGLARCGKSCRLRWLNYL 61
                     79******************99*************************7 PP

2Myb_DNA-binding59.57.5e-1967110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++l+++++ qlG++ W+tIa+ ++ gRt++++k++w++
       EPS66172.1  67 RGNFTKEEEDLIIQLHDQLGNK-WSTIAAQFP-GRTDNDIKNFWHT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.262961IPR017930Myb domain
SuperFamilySSF466895.47E-3211108IPR009057Homeodomain-like
SMARTSM007173.9E-121363IPR001005SANT/Myb domain
PfamPF002497.0E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-241568IPR009057Homeodomain-like
CDDcd001678.62E-101661No hitNo description
PROSITE profilePS5129425.92262116IPR017930Myb domain
SMARTSM007172.2E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1667110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2669116IPR009057Homeodomain-like
CDDcd001675.68E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MVKTSYVGHD GVKKGAWTEE EDEKLRAYIQ RYGHWNWNLL PKYAGLARCG KSCRLRWLNY  60
LKPGVKRGNF TKEEEDLIIQ LHDQLGNKWS TIAAQFPGRT DNDIKNFWHT TIAKRIERE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100326.16e-65PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH45e-53MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLS8E1I51e-85S8E1I5_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0019s14120.17e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.16e-53myb domain protein 15
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]