PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS66016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 107aa    MW: 12793.5 Da    PI: 10.8948
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS66016.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G+++W++Ia++++ gR++k+c++rw++ 
       EPS66016.1  4 RGHWRPGEDEKLRELVEKYGPHNWNAIAQKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding60.63.4e-195699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T eE+e+l+ +++ +G++ W+ Iar+++ gRt++ +k++w+ 
       EPS66016.1 56 RSPFTSEEEERLLACHRIHGNR-WAIIARHFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.232150IPR017930Myb domain
SMARTSM007176.4E-15352IPR001005SANT/Myb domain
SuperFamilySSF466892.73E-31497IPR009057Homeodomain-like
PfamPF002492.5E-18449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-28557IPR009057Homeodomain-like
CDDcd001671.13E-12748No hitNo description
PROSITE profilePS5129426.43951105IPR017930Myb domain
SMARTSM007179.5E-1655103IPR001005SANT/Myb domain
PfamPF002491.0E-155698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2258104IPR009057Homeodomain-like
CDDcd001678.23E-115898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MCSRGHWRPG EDEKLRELVE KYGPHNWNAI AQKLQGRSGK SCRLRWFNQL DPRINRSPFT  60
SEEEERLLAC HRIHGNRWAI IARHFPGRTD NAVKNHWHVI MARRCRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-3341057108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006441364.19e-71hypothetical protein CICLE_v10021859mg
RefseqXP_006478100.19e-71PREDICTED: transcription factor MYB82
SwissprotQ9FDW11e-38MYB44_ARATH; Transcription factor MYB44
TrEMBLS8CMK21e-75S8CMK2_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0012s03650.12e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-70myb domain protein 52
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]