PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS65487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 139aa    MW: 15847.5 Da    PI: 10.342
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS65487.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.8e-131462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+d +    g+ +W+++++  g+ R++k+c++rw +yl
       EPS65487.1 14 KGSWTAEEDRKLIDFILSSDGHcCWRAVPKLAGLLRCGKSCRLRWTNYL 62
                     799****************9999**********99************97 PP

2Myb_DNA-binding55.81e-1771112447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++eE+ + +d++++lG++ W++Ia+ ++ gRt++++k++w+++
       EPS65487.1  71 LSEEEERIVIDLHAKLGNR-WSKIASQLP-GRTDNEIKNHWNTH 112
                      699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-19564IPR009057Homeodomain-like
PROSITE profilePS5129410.63962IPR017930Myb domain
SuperFamilySSF466891.5E-2511109IPR009057Homeodomain-like
SMARTSM007172.6E-91364IPR001005SANT/Myb domain
PfamPF002498.2E-121462IPR001005SANT/Myb domain
CDDcd001675.61E-71662No hitNo description
PROSITE profilePS5129428.34663117IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2665118IPR009057Homeodomain-like
SMARTSM007173.9E-1667115IPR001005SANT/Myb domain
PfamPF002499.4E-1671112IPR001005SANT/Myb domain
CDDcd001673.49E-1272113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MGRKPCCDKV GLKKGSWTAE EDRKLIDFIL SSDGHCCWRA VPKLAGLLRC GKSCRLRWTN  60
YLRPDVKRGL LSEEEERIVI DLHAKLGNRW SKIASQLPGR TDNEIKNHWN THIKKKLKKL  120
GIDPLTHGPL NPPPPPEPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973482.12e-80PREDICTED: myb-related protein 315
RefseqXP_010525304.12e-80PREDICTED: protein ODORANT1-like
SwissprotQ50EX63e-76ODO1_PETHY; Protein ODORANT1
TrEMBLS8DZM63e-97S8DZM6_9LAMI; Uncharacterized protein (Fragment)
STRINGSi014144m7e-80(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.14e-80myb domain protein 20
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]