PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS65159.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family bZIP
Protein Properties Length: 358aa    MW: 40660.9 Da    PI: 8.5872
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS65159.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.42.4e-1169102235
                 XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekv 35 
                 k++k+ rr+++NReAAr+sR+RKka++++Le   
  EPS65159.1  69 KPDKVLRRLAQNREAARKSRLRKKAYVQQLESCK 102
                 789***************************9755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.7E-866117No hitNo description
SMARTSM003385.3E-868151IPR004827Basic-leucine zipper domain
PfamPF001703.1E-869105IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.51970114IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.04E-674115No hitNo description
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
PfamPF141442.8E-28159234IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
NTQFVPSRRM GLCDPIHQIV MWDDFKGSDY LDSSPAMMLD FEAKPEQQQV FSKNNTSGAS  60
HRYDQEATKP DKVLRRLAQN REAARKSRLR KKAYVQQLES CKQRLVQIER ELHQAKKQGF  120
SAGHSSETTT PHHGGTTLNQ CVVAFENEYR NWAEAQDRHV DDLKRALESN AGDSELDALV  180
ERGMKHYSHL FSMKASVAKA DVLYVMSGLW RSSAERFFFW MGGFRPSELI KVLAVHLEPL  240
SEQQRLDVSN LRQSCQQAED ALSHGIEKLH QIIADMIVGG RLGDGNCHLP EISAAAGKID  300
SLVRFAGQAD HLRQETLQQV TRILSPRQAA TCFLAMSDYF RRLQTLSSVW STRQRQTT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097616.11e-152TGACG-sequence-specific DNA-binding protein TGA-1A isoform X3
SwissprotP142321e-131TGA1A_TOBAC; TGACG-sequence-specific DNA-binding protein TGA-1A
TrEMBLS8CDV70.0S8CDV7_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.L00088.1.p1e-146(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-130TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Klinedinst S,Pascuzzi P,Redman J,Desai M,Arias J
    A xenobiotic-stress-activated transcription factor and its cognate target genes are preferentially expressed in root tip meristems.
    Plant Mol. Biol., 2000. 42(5): p. 679-88
    [PMID:10809441]
  2. Johnson C,Boden E,Desai M,Pascuzzi P,Arias J
    In vivo target promoter-binding activities of a xenobiotic stress-activated TGA factor.
    Plant J., 2001. 28(2): p. 237-43
    [PMID:11722767]
  3. Katagiri F,Seipel K,Chua NH
    Identification of a novel dimer stabilization region in a plant bZIP transcription activator.
    Mol. Cell. Biol., 1992. 12(11): p. 4809-16
    [PMID:1406663]
  4. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  5. Miao ZH,Lam E
    Construction of a trans-dominant inhibitor for members of the TGA family of transcription factors conserved in higher plants.
    Plant J., 1995. 7(6): p. 887-96
    [PMID:7599649]
  6. Pascuzzi P,Hamilton D,Bodily K,Arias J
    Auxin-induced stress potentiates trans-activation by a conserved plant basic/leucine-zipper factor.
    J. Biol. Chem., 1998. 273(41): p. 26631-7
    [PMID:9756903]