PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS65034.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 207aa    MW: 24140.3 Da    PI: 8.4553
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS65034.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l ++++ +G g W++ a+  g++Rt+k+c++rw++yl
       EPS65034.1 15 KGPWTMEEDLILMNYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding55.31.5e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
       EPS65034.1  68 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-23865IPR009057Homeodomain-like
PROSITE profilePS5129414.9381062IPR017930Myb domain
SuperFamilySSF466891.83E-3013109IPR009057Homeodomain-like
SMARTSM007171.2E-111464IPR001005SANT/Myb domain
PfamPF002494.7E-161562IPR001005SANT/Myb domain
CDDcd001675.91E-91762No hitNo description
PROSITE profilePS5129425.37363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2566118IPR009057Homeodomain-like
SMARTSM007171.8E-1567115IPR001005SANT/Myb domain
PfamPF002491.6E-1668111IPR001005SANT/Myb domain
CDDcd001677.51E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MDKNICKSPE AEVRKGPWTM EEDLILMNYI ANHGEGVWNS LAKSAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITPEEQLLIM ELHAKWGNRW SKIAKHLPGR TDNEIKNYWR TRIQKHMKQT  120
ENNNGTELIS DNCNDRASSS NLSSSGPALE SYSPTSFNTA IDAAPFDSNE HLWNMDDFWS  180
MHLLNDHNVS KNIYIYFFIM RIIYIYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618404.13e-99PREDICTED: myb-related protein 305-like
SwissprotP813914e-98MYB05_ANTMA; Myb-related protein 305
TrEMBLS8CDJ71e-155S8CDJ7_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc02g067760.2.16e-95(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-83myb domain protein 21
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]