PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64975.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 282aa    MW: 31321 Da    PI: 6.9144
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64975.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding544e-17348147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEde l  +v ++G ++W+ I+r ++ gR++k+c++rw + 
       EPS64975.1  3 RGPWSPEEDEALTMLVGKFGARNWSFISRGIP-GRSGKSCRLRWCNQ 48
                     89******************************.***********985 PP

2Myb_DNA-binding55.71.1e-175599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r ++T eEd ++++a+  +G++ W++Ia+ ++ gRt++ +k++w++ 
       EPS64975.1 55 RRPFTDEEDRIILEAHVIHGNK-WASIAKLLP-GRTDNAIKNHWNST 99
                     679*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.081149IPR017930Myb domain
SMARTSM007171.3E-14251IPR001005SANT/Myb domain
SuperFamilySSF466897.91E-31296IPR009057Homeodomain-like
PfamPF002496.4E-16348IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-26456IPR009057Homeodomain-like
CDDcd001671.13E-13547No hitNo description
PROSITE profilePS5129428.51650104IPR017930Myb domain
SMARTSM007176.2E-1754102IPR001005SANT/Myb domain
PfamPF002491.6E-155599IPR001005SANT/Myb domain
CDDcd001671.57E-125797No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2457104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
KVRGPWSPEE DEALTMLVGK FGARNWSFIS RGIPGRSGKS CRLRWCNQLD PRVKRRPFTD  60
EEDRIILEAH VIHGNKWASI AKLLPGRTDN AIKNHWNSTL RRRLTSLRRA TATETSKLSS  120
EDLHVNAFKL CDEMSQNQDE EKFGNENCCW PQKGADELKP RQSEDEAPND HEKAEENHST  180
VCRPTARIGA FRVYKCSGGL FPEQSSSPTI LKLMDGGEQA VPSHCGHGCC GSGTAATNKS  240
SLLGPEFVDY EELLATSPSP ELASLASDLD NIFSIRRGLD NA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-4221066110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615291.15e-91PREDICTED: transcription factor MYB122-like
RefseqXP_016434457.15e-91PREDICTED: transcription factor MYB122-like
TrEMBLS8CDQ00.0S8CDQ0_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc09g011780.2.13e-86(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26112454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-62myb domain protein 109
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]