PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64835.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family CO-like
Protein Properties Length: 297aa    MW: 32330.6 Da    PI: 4.9688
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64835.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.11.1e-05546237
    zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                ++++C+ + +  + lfC   +++lC  C   +H +      H
  EPS64835.1  5 SAKRCDYCRSVGAVLFCCAESTFLCIACDNRIHVRgeaaarH 46
                5789******99*********************554555556 PP

2zf-B_box27.75.6e-094993341
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                 ++C+ +e+ ++ + C+ ++  lC +C   +H+       H++ p
  EPS64835.1 49 VWVCEVCEQAPAAFACKADSASLCVECDGDIHSAnplarrHERAP 93
                689*****************************6578888888766 PP

3CCT69.11.1e-23240283144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 R+a++lRY+eKr++R+FeK+irY+sRKa+Ae+RpR+KGrFvk++
  EPS64835.1 240 RKARVLRYREKRRNRNFEKTIRYASRKAYAETRPRIKGRFVKKT 283
                 9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.958451IPR000315B-box-type zinc finger
SMARTSM003363.0E-5451IPR000315B-box-type zinc finger
CDDcd000212.95E-5851No hitNo description
PROSITE profilePS5011910.0114794IPR000315B-box-type zinc finger
PfamPF006433.0E-74993IPR000315B-box-type zinc finger
CDDcd000219.06E-85094No hitNo description
SMARTSM003363.8E-95294IPR000315B-box-type zinc finger
PfamPF062034.2E-18240282IPR010402CCT domain
PROSITE profilePS5101716.618240282IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
GWDSSAKRCD YCRSVGAVLF CCAESTFLCI ACDNRIHVRG EAAARHGRVW VCEVCEQAPA  60
AFACKADSAS LCVECDGDIH SANPLARRHE RAPVLPFYDS AEAAAANAAA ASSLLVPVGG  120
GGDDIDDDIF AVDPIVTRKL DPIDDGLDFK SVEFLFSDLD QTLDFDNFRI YAEQNDGVSV  180
DTNTTSFGMN FYDPNFNAAA ATTSGSFTTR SNSVSSSSID GGEISHNFRG GQPSSSIDDR  240
KARVLRYREK RRNRNFEKTI RYASRKAYAE TRPRIKGRFV KKTSESDGNF SSGDGDD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079319.16e-85zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-73COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLS8CDB40.0S8CDB4_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.K00262.1.p1e-80(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-48CONSTANS-like 5
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]