PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64788.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 459aa    MW: 51551.4 Da    PI: 9.7965
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64788.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.5e-07190231346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT  E e ++d  + +G++ +++I++ +  ++t  +c+++++k
       EPS64788.1 190 TWTSSEREVFIDKLASFGKD-FRKISSFLD-HKTVADCVEFYYK 231
                      7*****************99.*********.***********98 PP

2Myb_DNA-binding34.93.5e-11411451446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      WT +E   +v+av ++G++ ++ I+r++  +R+ kqck ++ k
       EPS64788.1 411 WTDDEKSAFVRAVSMYGKD-FSMISRCVR-TRSKKQCKVFFSK 451
                      *****************99.*********.********88765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.08E-13174235IPR009057Homeodomain-like
PROSITE profilePS5129314.086186237IPR017884SANT domain
SMARTSM007176.0E-7187235IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-7406451IPR009057Homeodomain-like
PROSITE profilePS5129311.684406457IPR017884SANT domain
SuperFamilySSF466893.21E-11406457IPR009057Homeodomain-like
SMARTSM007171.6E-8407455IPR001005SANT/Myb domain
CDDcd001675.98E-8411449No hitNo description
PfamPF002491.7E-8411450IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
TYESIISSNK VTWTVTLEEL SQLLPSGQRF FDLSTPSHGS SSTTDLTAVG KNFLRKRRAL  60
QFNERSLILK YKACKHFWKE GRVVSVRKLR GKSQKRFDQS QALHKKNRSC RSRLTHSGGT  120
DNPPLTVPAE ELVDFVNRLL SSSPFKPYRR ILRMPALIID RQTKESRFVS SNGLVEDPLA  180
LEKERYLINT WTSSEREVFI DKLASFGKDF RKISSFLDHK TVADCVEFYY KNHKSECFSR  240
AKRKSGSSEQ RKSQPSSTYL VTAGKRWSRE AGAVSLDILG EASAIAASND GYVESQPKYK  300
SRMFFPSSRY YDSPRGGGDD GRLLAPESID VYNGETAAVD VLAGICGSLS SEAMSSCITS  360
SIDPQDGGIL DLRLQRVNSC VKRPLTPPDV TQIVDKECSE ESCEAVNSAH WTDDEKSAFV  420
RAVSMYGKDF SMISRCVRTR SKKQCKVFFS KARKCLGLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C4e-17149238493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D4e-17149238493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834923.11e-175PREDICTED: uncharacterized protein LOC105955688
TrEMBLS8DP320.0S8DP32_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_13s0019g04010.t011e-131(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59042332
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.16e-85MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]