PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64753.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 303aa    MW: 34037.1 Da    PI: 8.2408
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64753.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.8e-18114160148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ed llv+ v+++G + W++Ia+ ++ gR +kqc++rw+++l
       EPS64753.1 114 KGQWTPQEDGLLVEMVEKHGVRKWSAIAQVLP-GRIGKQCRERWHNHL 160
                      799*****************************.*************97 PP

2Myb_DNA-binding551.9e-17166208145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++rW++eEd +l+ a+++lG++ W+ Iar ++ gR+++ +k++w+
       EPS64753.1 166 KDRWSEEEDMILISAHRLLGNR-WAEIARSLP-GRSENTIKNHWN 208
                      68********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.971109164IPR017930Myb domain
SuperFamilySSF466893.06E-31112207IPR009057Homeodomain-like
SMARTSM007172.3E-16113162IPR001005SANT/Myb domain
PfamPF002491.5E-17114160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-29115167IPR009057Homeodomain-like
CDDcd001671.14E-15117160No hitNo description
SMARTSM007173.4E-16165213IPR001005SANT/Myb domain
PROSITE profilePS5129420.17165215IPR017930Myb domain
PfamPF002492.3E-15166208IPR001005SANT/Myb domain
CDDcd001679.24E-13168211No hitNo description
Gene3DG3DSA:1.10.10.604.9E-21168215IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MDFFHPQNLH HIAVKLFDES PEETIGFSPS YAFNLYDYHL LSSFSDPFSD FLPLHGDGSL  60
TEEGTAIATA QNASTVSNRS NSDDRRKATK KKKKSREATK RKRAVDDRKS EIVKGQWTPQ  120
EDGLLVEMVE KHGVRKWSAI AQVLPGRIGK QCRERWHNHL KPNIKKDRWS EEEDMILISA  180
HRLLGNRWAE IARSLPGRSE NTIKNHWNAT KRKQLSSRRN GAAGGSAKSS NSPLQEYIRS  240
VISDEGGCVS GNHSKSDVAV ENSSNASGGD ECCCLMVPPL DISMQFDLQK EMDFMEMLSN  300
GSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-441112151105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
184102RRKATKKKKKSREATKRKR
289102KKKKKSREATKRKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00385DAPTransfer from AT3G27785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012850795.15e-81PREDICTED: myb-like protein AA
TrEMBLS8DNZ60.0S8DNZ6_9LAMI; Uncharacterized protein
STRINGfgenesh2_kg.5__560__AT3G27785.14e-63(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.17e-59myb domain protein 118
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]