PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 280aa    MW: 31548.7 Da    PI: 7.4378
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64660.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.6e-14449146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEd+ l++ vk++G+++W++I ++  ++Rt+k+c++rw +
       EPS64660.1  4 KGPWKPEEDQVLINHVKKYGPRDWSSIRSKGLLKRTGKSCRLRWVN 49
                     79*************************888779***********87 PP

2Myb_DNA-binding43.47.8e-146099344
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     ++++eE++  +++ +q+G++ W++Ia ++  gRt++++k++w
       EPS64660.1 60 KFSPEEEKTVLELQAQFGNR-WAKIATYLT-GRTDNDVKNFW 99
                     89******************.********9.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.007155IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-21252IPR009057Homeodomain-like
SuperFamilySSF466892.51E-28299IPR009057Homeodomain-like
SMARTSM007171.2E-12353IPR001005SANT/Myb domain
PfamPF002491.2E-12449IPR001005SANT/Myb domain
CDDcd001674.96E-13651No hitNo description
Gene3DG3DSA:1.10.10.605.4E-1853105IPR009057Homeodomain-like
PROSITE profilePS5129416.1556107IPR017930Myb domain
SMARTSM007172.8E-1257105IPR001005SANT/Myb domain
CDDcd001671.26E-106099No hitNo description
PfamPF002491.2E-126099IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
DIKKGPWKPE EDQVLINHVK KYGPRDWSSI RSKGLLKRTG KSCRLRWVNK LRPDLKNGVK  60
FSPEEEKTVL ELQAQFGNRW AKIATYLTGR TDNDVKNFWS SRQKRIARMQ GGTTSPPSPN  120
KTATSAKETK LSVVHDVSPS EAVKFLCSST TTDEESVITM PRQLLPLPPL GNPISRCYGS  180
SSFFPLELSY ESKPQFFVEQ PQSFFPRPQH PLLDFFGNYS EPTLSGTAFL PQLPDEAAAL  240
GGGMMDSSFQ SENVDDAFLD EFPLMDLFDE IEPLPSPSKW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-28110524126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016502014.17e-80PREDICTED: transcription factor MYB57-like
RefseqXP_009768446.18e-80PREDICTED: transcription factor MYB57-like
TrEMBLS8CCM50.0S8CCM5_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc01g090530.1.19e-76(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42072342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.14e-67MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]