PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64534.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 267aa    MW: 30816.4 Da    PI: 5.02
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64534.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.86.1e-19101146248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g WT+eEd llv++v+++G + W+ Ia+++  gR +kqc++rw+++l
       EPS64534.1 101 GQWTPEEDRLLVKLVEEHGIRKWSQIAQMLE-GRIGKQCRERWHNHL 146
                      78*****************************.*************97 PP

2Myb_DNA-binding55.71.1e-17152194145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eEd +l++ +k+lG++ W+ I+++++ gRt++++k++w+
       EPS64534.1 152 KDNWTEEEDRILIRSHKELGNK-WAEISKRLP-GRTENSIKNHWN 194
                      689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.34390146IPR017930Myb domain
SMARTSM007171.0E-1699148IPR001005SANT/Myb domain
SuperFamilySSF466893.95E-32100193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-30101154IPR009057Homeodomain-like
PfamPF139216.0E-20103160No hitNo description
CDDcd001671.13E-15103146No hitNo description
PROSITE profilePS5129427.316147201IPR017930Myb domain
SMARTSM007172.6E-17151199IPR001005SANT/Myb domain
CDDcd001671.94E-13154197No hitNo description
Gene3DG3DSA:1.10.10.602.0E-22155201IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MEFYNNDENA PPPYIKTPTD DDDGDCCYFM DPRWIQFQSS LDPLFFDDCF VADFHDDPLA  60
EFVIPPPDET SSSSAAAAAI APPVKKQAEK RGRRKGKSGN GQWTPEEDRL LVKLVEEHGI  120
RKWSQIAQML EGRIGKQCRE RWHNHLRPDI KKDNWTEEED RILIRSHKEL GNKWAEISKR  180
LPGRTENSIK NHWNATKRRQ LSRRKCRTKF SRPDSILQNY ITSLNGTAEG AADSDASAAL  240
EYDYAEDMEM DLAPLMMDNA VDFFFDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-451012015105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-451012015105C-Myb DNA-Binding Domain
1msf_C2e-451012015105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576336.14e-76PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L23e-69MYB98_ARATH; Transcription factor MYB98
TrEMBLS8CC500.0S8CC50_9LAMI; Uncharacterized protein
STRINGPGSC0003DMT4000873248e-75(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.19e-69myb domain protein 98
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]